Recombinant Human Killer cell immunoglobulin-like receptor 2DS3(KIR2DS3),partial

Code CSB-BP613530HU
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. Q14952
Abbreviation KIR2DS3
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Research Area Others
Source Baculovirus
Gene Names KIR2DS3
Protein Names MHC class I NK cell receptor Natural killer-associated transcript 7 Short name: NKAT-7 NKAT7
Expression Region 22-245aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal MBP-tagged and C-terminal 6xHis-tagged
Mol. Weight 68.7 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Subcellular location Cell membrane, Single-pass type I membrane protein
Pathway Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR2DS3 Antibodies

KIR2DS3 Antibodies for Homo sapiens (Human)

KIR2DS3 cDNA

KIR2DS3 cDNA for Homo sapiens (Human)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.