Recombinant Human Lactoylglutathione lyase (GLO1)

In Stock
Code CSB-EP871864HU
Abbreviation Recombinant Human GLO1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
GLO1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Aldoketomutase; glo1; GLOD1; Glx I; GLYI; glyoxalase domain containing 1; Glyoxalase I; Ketone aldehyde mutase ; Ketone-aldehyde mutase; Lactoyl glutathione lyase ; Lactoylglutathione lyase; LGUL_HUMAN; Methylglyoxalase; S D lactoylglutathione methylglyoxal lyase ; S-D-lactoylglutathione methylglyoxal lyase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-184aa
Target Protein Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis.
Gene References into Functions
  1. GLO1 SNPs, rs1130534 (c.372A>T, p.G124G), rs2736654 (c.A332C, p.E111A) and rs1049346 (c.-7C>T, 5'-UTR) were genotyped. While c.A332C polymorphism was not associated with retinitis pigmentosa (RP), c.372A>T showed an allelic association. Conversely, c.-7C>T showed both genotypic and allelic associations. RP susceptibility may be associated with two of the analyzed GLO1 polymorphisms (rs1130534 and rs1049346). PMID: 30099685
  2. The active sites of human and staphylococcus glyoxalases I are also different: the former contains one Zn-ion per chain; the latter incorporates two of these ions.. We suggest that only single Zn1-ion plays the role of catalytic center. The newly found differences between the two subfamilies could guide the design of new drugs against S. aureus, an important pathogenic micro-organism. PMID: 28034013
  3. This study shows that only the GLO1 C-7T polymorphism, and not the GLO1 A419C and ALR C-106T polymorphisms, is associated with carotid atherosclerosis in Chinese patients with type 2 diabetes. PMID: 21294693
  4. The expression of glyoxalase system member glyoxalase 1 (GLO1) in melanoma cells is downregulated by miR-137. siRNA targeting of GLO1 mimicks inhibition of melanoma cell proliferation caused by miR-137 overexpression. Re-expression of GLO1 restores miR-137-mediated suppression of melanoma cell proliferation. PMID: 29307109
  5. The critical role of glyoxalases as regulators of tumorigenesis in the prostate through modulation of various critical signaling pathways, and an overview of the current knowledge on glyoxalases in bladder, kidney and testis cancers is reviewed.(GLO1, GLO2) PMID: 29385039
  6. Inhibition of GLO1 in Glioblastoma Multiforme Increases DNA-AGEs, Stimulates RAGE Expression, and Inhibits Brain Tumor Growth in Orthotopic Mouse Models PMID: 29385725
  7. current research highlighted the Glo-I/AGE/RAGE system as an interesting therapeutic target in chronic liver diseases. These findings need further elucidation in preclinical and clinical studies. PMID: 29156655
  8. GLO1-knockdown provoked collagen expression, endothelial inflammation and dysfunction and apoptosis which might contribute to vascular damage PMID: 27898103
  9. expressed in basal epidermis; significantly higher expression in older individuals PMID: 26914966
  10. Interdependence of GLO I and PKM2 in the Metabolic shift to escape apoptosis in GLO I-dependent cancer cells. PMID: 29225125
  11. Induced Glyoxalase 1 expression is a common feature in the pathogenesis of oropharyngeal squamous cell carcinoma PMID: 28549423
  12. The lowering of glycative stress via modulation of RAGE-AGE axis or glyoxalase 1 activity is beneficial for tubular homeostasis and the subsequent prevention and treatment of kidney disease, suggesting the possibility of novel therapeutic approaches which target glycative stress. PMID: 27270765
  13. Glo-1 responds to dicarbonyl stress to enhance cytoprotection at the transcriptional level through stress-responsive increase of Glo-1 expression. PMID: 27406712
  14. Glo1, together with Glo2, represents a novel mechanism in prostate cancer progression driven by a PTEN/PI3K/AKT/mTOR signaling pathway. PMID: 27696457
  15. Gly82Ser and 2184 A/G RAGE polymorphisms were related to the mortality due to the breast cancer and -419 A/C glyoxalase I polymorphism was related to the overall mortality of the patients suggesting their role not only in the risk of breast cancer but also in the outcome of patients with breast cancer. PMID: 28695773
  16. Reduction of GLO1 activity in atherosclerotic lesions of nondiabetic patients with increased HbA1c is associated with a functional involvement of this protective enzyme in atherogenesis. PMID: 27478003
  17. Studies suggest that the enhancement of glyoxalase I (GLO-1) is a promising strategy aimed at halting the vicious cycle between chronic kidney disease and increases in glycative stress. PMID: 28106734
  18. GLO1 on one hand is crucial to maintaining tumor characteristics of malignant cells, and, on the other hand, supports malignant transformation of cells in a hypoxic environment when overexpressed. PMID: 27999356
  19. GLO1 SNPs are significantly associated with late-onset and drug-resistant epilepsy. PMID: 27000251
  20. MS5 induced hydrogen peroxide-mediated c-Jun-dependent Glo1 up-regulation which resulted in a decrease in the Argpyrimidine-modified Hsp70 protein level which triggered EMT in a novel mechanism involving miR-21 and SMAD signalling PMID: 26784015
  21. MMP-9 and Bcl-2 expression levels were dramatically decreased by addition of methylglyoxal or inhibition of GLOI. These findings may provide a new approach for the treatment of breast cancer. PMID: 26618552
  22. Data suggest Glo1's effects on anxiety-like behavior are centrally mediated as overexpression of Glo1 in neurons was sufficient to increase anxiety-like behavior PMID: 26711908
  23. Studies indicate that the most extensively investigated The most extensively investigated glyoxalase enzymes are glyoxalase I and glyoxalase II (Glo1 and Glo2). PMID: 26552067
  24. The GLO1 variations were not the source of association of the BTBD9 locus with restless legs syndrome. PMID: 26298793
  25. Glo1 is involved in the Min-U-Sil 5 crystalline silica-induced BEAS-2B cell mitochondrial apoptotic pathway. PMID: 25841781
  26. Two classes of the metalloenzyme GlxI exist and vary in their metal dependencies PMID: 25557363
  27. GLO1 activity affects the overall burden of carotid artery atherosclerosis. PMID: 24767709
  28. individuals with the GLO1 A /E genotype, PON192/QR-RR genotypes and PON55/LM-MM genotypes had a significantly higher risk of cerebral cavernous malformations compared with the other genotypes. PMID: 26122242
  29. This study demonstrated that the GLO1 C332 (Ala111) allele confers autism vulnerability by reducing brain glyoxalase activity and enhancing advanced glycation end-products. formation PMID: 25201284
  30. This review describes the role of GLO1 in tumor cell proliferation and survival, and the potential of GLO1 as a biomarker for tumor diagnosis and as a target for anticancer drug development. [review] PMID: 25342507
  31. Significant differences in the allelic and genotype frequencies of GLO1. PMID: 25407489
  32. In ApoE(-/-) mice with or without diabetes, GLO1 overexpression did not lead to decreased atherosclerotic lesion size or systemic inflammation. PMID: 25139743
  33. Data show that GlxI is a novel substrate of TG2 and TG2 catalyzes either polyamine conjugation or deamidation depending the presence of polyamines. PMID: 24494193
  34. results suggested involvement of accumulated dicarbonyls and/or pentosidine in the pathophysiology of schizophrenia patients carrying Glyoxalase-1 mutations. PMID: 24995521
  35. Study demonstrates that GLO1 is a novel metabolic oncogene of the 6p21 amplicon, which promotes tumor growth and aberrant transcriptional signals via regulating cellular metabolic activities for energy production. PMID: 24662817
  36. GLO1 lessened inhibitory phosphorylation of eNOS (Thr495) by reducing glycative stress. Study demonstrates that blunting glycative stress prevents the long-term impact of endothelial dysfunction on vascular aging. PMID: 24612481
  37. GLO1 is prevailingly expressed in cutaneous neoplasms of higher malignancy and contributes to the progression of squamous cell carcinoma PMID: 25184957
  38. Weak association of glyoxalase 1 (GLO1) variants with autism spectrum disorder PMID: 24671236
  39. Suggest Glo1 pathway activation is required for cell proliferation and cell survival of hepatocellular carcinoma cells carrying Glo1 genetic amplification. PMID: 24966916
  40. Report association of GLO1 (rs4746) polymorphism with markers of endothelial activation in diabetes mellitus. PMID: 24908234
  41. Overexpression of GLO1 in bone marrow cells is sufficient to overcome the defective neovascularization that is characteristic of diabetes. PMID: 24259499
  42. Overall, thus Glo1 might be essential for hepatocellular carcinoma progression and can be designated as a potential therapeutic target for hepatocellular carcinoma in the future. PMID: 24158671
  43. level by differently inhibiting GI via NF-kappaB.Superoxide anion and hydrogen peroxide induced a diverse apoptosis. PMID: 24002659
  44. we provided evidence of the biological plausibility of Glyoxalase 1 polymorphism, either alone or in combination with other ones, all related to oxidative stress control that represents a key event in PCa development and progression. PMID: 24040147
  45. GLO1 was the only protein which consistently varied according to the metastatic potentials of SN12C clones. GLO1 was increased in high metastatic cell lines by western blot analysis. PMID: 23982595
  46. data suggest a possible association of C332C-genotype of the glyoxalase 1 gene with diabetic neuropathy in type 2 diabetes, supporting the hypothesis that methylglyoxal might be an important mediator of diabetic neuropathy in type 2 diabetes. PMID: 23775136
  47. GLO1 expression level in prostate cancer tissues correlates with pathological grade and proliferation rate. PMID: 24105621
  48. Data suggest that GLO1 activity is lower in blood (in whole blood assay) in type 1 or type 2 diabetes with painful peripheral diabetic neuropathy as compared to control subjects; Glo1 activity negatively correlates with duration of type 1 diabetes. PMID: 23351995
  49. The Ala111Glu glyoxalase gene polymorphism did not have an effect on glyoxalase 1 activity in either the type 1 diabetes mellitus or healthy control group. PMID: 23360186
  50. No evidence of an association of RAGE or glyoxalase I single nucleotide polymorphisms with pathological pregnancy. PMID: 22771726

Show More

Hide All

Protein Families
Glyoxalase I family
Database Links

HGNC: 4323

OMIM: 138750

KEGG: hsa:2739

STRING: 9606.ENSP00000362463

UniGene: Hs.268849

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*