Recombinant Human Laminin subunit alpha-5 (LAMA5), partial

In Stock
Code CSB-EP012729HU
Abbreviation Recombinant Human LAMA5 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP012729HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAMA5.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP012729HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAMA5.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
KIAA0533; KIAA1907; LAMA5; LAMA5_HUMAN; Laminin alpha 5 chain; Laminin subunit alpha 5; Laminin subunit alpha-5; Laminin; alpha 5; Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha; RP11-157P1.6
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3401-3692aa
Target Protein Sequence
FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Laminin subunit alpha-5 (LAMA5) is a vital protein involved in various biological processes. Laminins are a family of proteins that constitute a significant part of basement membranes, crucial for maintaining tissue integrity [1]. LAMA5 acts as a specific receptor for laminin-511 (LM-511), a key component of basement membranes [2]. Research has demonstrated that LAMA5 is essential for regulating dendritic spine structure and ensuring synapse stability in the brain [3]. In mammary glands, the expression of LAMA5 in luminal epithelial cells is necessary for normal growth and development [4]. Additionally, LAMA5 is associated with preserving the integrity of the intestinal basement membrane, emphasizing its role in gastrointestinal health [5].

Moreover, LAMA5 is implicated in various diseases and conditions. It has been linked to promoting tumor cell migration in cancers such as ovarian cancer and colorectal liver metastasis [6][7]. Mutations in the LAMA5 gene have been connected to conditions like infantile nephrotic syndrome and skeletal dysplasia [8][9]. Furthermore, LAMA5 contributes to hair morphogenesis and tooth development [10][11].

Furthermore, LAMA5 is critical for kidney glomerular basement membrane assembly, and its deficiency can lead to conditions like polycystic kidney disease [12][13]. The protein also interacts with other molecules such as integrins and dystroglycans to facilitate basement membrane assembly and tissue polarization [14].

References:
[1] L. Jones, R. Lam, K. McKee, M. Aleksandrova, J. Dowling, S. Alexanderet al., "A mutation affecting laminin alpha 5 polymerisation gives rise to a syndromic developmental disorder", Development, 2020. https://doi.org/10.1242/dev.189183
[2] Y. Kikkawa, T. Ogawa, R. Sudo, Y. Yamada, F. Katagiri, K. Hozumiet al., "The lutheran/basal cell adhesion molecule promotes tumor cell migration by modulating integrin-mediated cell attachment to laminin-511 protein", Journal of Biological Chemistry, vol. 288, no. 43, p. 30990-31001, 2013. https://doi.org/10.1074/jbc.m113.486456
[3] S. Luo, Z. Liu, J. Wang, J. Luo, X. Ye, X. Liet al., "Recessive lama5 variants associated with partial epilepsy and spasms in infancy", Frontiers in Molecular Neuroscience, vol. 15, 2022. https://doi.org/10.3389/fnmol.2022.825390
[4] J. Englund, A. Ritchie, L. Blaas, H. Cojoc, N. Pentinmikko, J. Döhlaet al., "Laminin alpha 5 regulates mammary gland remodeling through luminal cell differentiation and wnt4-mediated epithelial crosstalk", Development, vol. 148, no. 12, 2021. https://doi.org/10.1242/dev.199281
[5] Y. Park, E. Ha, K. Gu, G. Shin, C. Lee, K. Kimet al., "Host genetic and gut microbial signatures in familial inflammatory bowel disease", Clinical and Translational Gastroenterology, vol. 11, no. 7, p. e00213, 2020. https://doi.org/10.14309/ctg.0000000000000213
[6] S. Sivakumar, S. Lieber, D. Librizzi, C. Keber, L. Sommerfeld, F. Finkernagelet al., "Basal cell adhesion molecule promotes metastasis‐associated processes in ovarian cancer", Clinical and Translational Medicine, vol. 13, no. 1, 2023. https://doi.org/10.1002/ctm2.1176
[7] A. Gordon-Weeks, S. Lim, A. Yuzhalin, S. Lucotti, J. Vermeer, K. Joneset al., "Tumour-derived laminin α5 (lama5) promotes colorectal liver metastasis growth, branching angiogenesis and notch pathway inhibition", Cancers, vol. 11, no. 5, p. 630, 2019. https://doi.org/10.3390/cancers11050630
[8] Y. Taniguchi, C. Nagano, K. Sekiguchi, N. Sato, H. Sakaguchi, C. Umedaet al., "Clear evidence of lama5 gene biallelic truncating variants causing infantile nephrotic syndrome", Kidney360, vol. 2, no. 12, p. 1968-1978, 2021. https://doi.org/10.34067/kid.0004952021
[9] M. Barad, F. Csukasi, M. Bosakova, J. Martín, W. Zhang, S. Tayloret al., "Biallelic mutations in lama5 disrupts a skeletal noncanonical focal adhesion pathway and produces a distinct bent bone dysplasia", Ebiomedicine, vol. 62, p. 103075, 2020. https://doi.org/10.1016/j.ebiom.2020.103075
[10] S. Fukumoto, J. Miner, H. Ida, E. Fukumoto, K. Yuasa, H. Miyazakiet al., "Laminin α5 is required for dental epithelium growth and polarity and the development of tooth bud and shape", Journal of Biological Chemistry, vol. 281, no. 8, p. 5008-5016, 2006. https://doi.org/10.1074/jbc.m509295200
[11] J. Gao, M. DeRouen, C. Chen, M. Nguyen, N. Ngôn, H. Idoet al., "Laminin-511 is an epithelial message promoting dermal papilla development and function during early hair morphogenesis", Genes & Development, vol. 22, no. 15, p. 2111-2124, 2008. https://doi.org/10.1101/gad.1689908
[12] M. Shannon, B. Patton, S. Harvey, & J. Miner, "A hypomorphic mutation in the mouse laminin α5 gene causes polycystic kidney disease", Journal of the American Society of Nephrology, vol. 17, no. 7, p. 1913-1922, 2006. https://doi.org/10.1681/asn.2005121298
[13] B. Steenhard, A. Zelenchuk, L. Stroganova, K. Isom, P. John, G. Andrewset al., "Transgenic expression of human lama5 suppresses murine lama5 mrna and laminin α5 protein deposition", Plos One, vol. 6, no. 9, p. e23926, 2011. https://doi.org/10.1371/journal.pone.0023926
[14] S. Li, Y. Qi, K. McKee, J. Liu, J. Hsu, & P. Yurchenco, "Integrin and dystroglycan compensate each other to mediate laminin-dependent basement membrane assembly and epiblast polarization", Matrix Biology, vol. 57-58, p. 272-284, 2017. https://doi.org/10.1016/j.matbio.2016.07.005

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Gene References into Functions
  1. The finding of rare LAMA5 variants together with FLT4 and FOXC2 mutations in Milroy disease and lymphedema-distichiasis syndrome suggests that these mutations may be co-responsible for these disorders and most likely interfere with the function of lymphatics. PMID: 29908552
  2. This study shows that specific laminin alpha5 substrates provide a controlled in vitro culture environment for human pluripotent stem cells-derived neurons. PMID: 28926760
  3. study describes the first LAMA5 mutation that causes a novel complex extracellular matrix syndrome PMID: 28735299
  4. data show that the BCAM/LAMA5 system plays a functional role in the metastatic spreading of KRAS-mutant colorectal cancer PMID: 27143691
  5. Taken together, these data suggest that alpha5-containing laminins repress intestinal differentiation in its early stages. PMID: 29198708
  6. We report here a severe defect of neuromuscular transmission in a consanguineous patient with a homozygous variant in the laminin alpha-5 subunit gene (LAMA5). The variant c.8046C>T (p.Arg2659Trp) is rare and has a predicted deleterious effect. The affected individual, who also carries a rare homozygous sequence variant in LAMA1, had muscle weakness, myopia, and facial tics PMID: 28544784
  7. The Laminin-511 consists of alpha5, beta1, and gamma1 chains, of which three laminin globular domains of the alpha5 chain (alpha5/LG1-3) and a Glu residue in the C-terminal tail of chain gamma1 (gamma1-Glu1607) are required for binding to integrins. PMID: 28412362
  8. The association of LAMA5 rs4925386 alleles with both inter-individual differences in height and in longevity suggests that laminins may be among the factors linking stature and cancer susceptibility. PMID: 26968355
  9. disruption of the LAMA5 gene dramatically reduced hPSC self-renewal and increased apoptosis without affecting the expression of pluripotency markers. PMID: 26235893
  10. Gal-1 decreased the expression of collagen genes COL3A1 and COL5A1 but increased the expression of fibronectin and laminin 5. PMID: 24503541
  11. Lutheran (Lu), also known as basal cell adhesion molecule (B-CAM), competes with integrins for binding to laminin alpha5, a subunit of LM-511, a major component of basement membranes. PMID: 24036115
  12. The laminin-5 staining pattern was significantly more often continuous in severe dysplasia/carcinoma-in-situ PMID: 23715200
  13. mechanistic role of laminin-511 in tissue homeostasis PMID: 22666383
  14. Polymorphisms in LN5 were associated with a reduced level of hemoglobin and neutropenia in non-small cell lung cancer. PMID: 21461966
  15. These results indicate specific laminin isoforms and integrins in maintenance of human embryonic stem cells pluripotency in feeder-dependent cultures. PMID: 22099024
  16. PDGF-BB is not superior to laminin as a potential marker of advanced CP. PMID: 21921666
  17. Data indicate that the function-blocking antibody against Lu/B-CAM should be useful for not only investigating cell adhesion to laminin alpha5 but also for developing drugs to inhibit sickle cell vaso-occlusion. PMID: 21858073
  18. Cytoplasmic and basement membrane laminin is important in the pathogenesis and invasion of basal cell carcinoma. PMID: 19615022
  19. investigated the relation between epithelial-mesenchymal transition criteria and laminin-332 expression in a cell culture model of transforming growth factor beta-1 (TGFbeta1)/epithelial growth factor (EGF) long time co-stimulation. PMID: 20819124
  20. Abnormal distribution of laminin alpha1 and laminin alpha5 in glomerular basement membrane is correlated with GBM thickening and splitting in human Alport's syndrome. PMID: 20019771
  21. LAMA5 rs659822 regulates anthropometric and metabolic traits in elderly people PMID: 20951195
  22. Data from experiment with peptide fragments suggest laminin alpha5 (and laminin alpha4) may be part of host defense response and may protect tissues from invading pathogens. PMID: 20433883
  23. Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways (Laminin 10; separate entry for Laminin 11). PMID: 11891225
  24. LN5 has a role in the differentiation of the tracheal epithelium in human embryos PMID: 12242717
  25. LN6 and LN5 have distinct biological activities, but they may cooperatively support cell adhesion PMID: 12379663
  26. role for laminin-5 during human embryogenesis, for example, for epithelial cell development, beyond its involvement in hemidesmosome formation and cell adhesion. PMID: 12382139
  27. Laminins with alpha1, alph4, and alpha5 chains are compared to determine laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells. PMID: 12393739
  28. Our results elucidate a mechanism whereby mesangial cells organize the glomerular capillaries by adhering to the G domain of laminin alpha5 in the glomerular basement membrane. PMID: 12682087
  29. Data suggest that laminin-10 (alpha5beta1gamma1) is required for hair follicle development and report the first use of exogenous protein to correct a cutaneous developmental defect. PMID: 12743034
  30. Incubation of mouse macrophages with human laminin alpha5 chain peptide results in marked increase in matrix metalloproteinase-9 mRNA and gelatinolytic activity; this peptide is chemotactic for mouse neutrophils and macrophages in vitro and in vivo. PMID: 12817023
  31. Autocrine LM-5 mediates anchorage-independent survival in breast tumors through ligation of a wild-type, but not a cytoplasmic tail-truncated alpha6beta4 integrin. PMID: 14691145
  32. prostate cancer cells expressing high levels of MT1-MMP have increased invasive potential through their ability to degrade and invade Ln-10 barriers PMID: 15967115
  33. Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5 PMID: 15975931
  34. An increase was noted in LAMA5 immunostaining in the dilated muscle of the ganglionic bowel upstream the distal aganglionic region in a group of Hirschprung disease patients. PMID: 16226104
  35. Results describe the expression of laminin 5 by parental and c-Ha-ras-transformed HaCaT keratinocytes in organotypic cultures. PMID: 16460839
  36. laminin 5 and p16INK4A have roles in wound healing and senescence PMID: 16723698
  37. The results indicate that glioma cells secrete alpha2-, alpha4- and alpha5-laminins and that alpha3- and alpha5-laminins, selectively promote glioma cell migration and identify alpha3beta1 as the predominant integrin and laminin receptor in glioma cells. PMID: 17888902
  38. alpha5-laminin was the most adhesion- and migration-promoting isoform for human blood lymphocytes, followed by alpha3- (Lm-332) and alpha4- (Lm-411) laminins. PMID: 18523231
  39. These results suggest that laminins containing alpha 5 serve as functional substrates regulating progression of hepatocellular carcinoma. PMID: 18635166
  40. results suggest an evolutionarily conserved role of a member of the laminin gene family in contributing to variation in weight and body composition PMID: 18694491

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane. Note=Major component.
Tissue Specificity
Expressed in heart, lung, kidney, skeletal muscle, pancreas, retina and placenta. Little or no expression in brain and liver.
Database Links

HGNC: 6485

OMIM: 601033

KEGG: hsa:3911

STRING: 9606.ENSP00000252999

UniGene: Hs.473256

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*