Recombinant Human Laminin subunit alpha-5(LAMA5),partial

In Stock
Code CSB-EP012729HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. O15230
Relevance Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other Extracellular domain matrix components.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP012729HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAMA5.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP012729HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAMA5.
Storage Buffer Tris-based buffer,50% glycerol
Alias Laminin-10 subunit alpha Laminin-11 subunit alpha Laminin-15 subunit alpha
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC
Research Area Neuroscience
Source E.coli
Gene Names LAMA5
Expression Region 3401-3692aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 47.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Subcellular Location Secreted, extracellular space, extracellular matrix, basement membrane
Tissue Specificity Expressed in heart, lung, kidney, skeletal muscle, pancreas, retina and placenta. Little or no expression in brain and liver.
Database Links

HGNC: 6485

OMIM: 601033

KEGG: hsa:3911

STRING: 9606.ENSP00000252999

UniGene: Hs.473256

Pathway PI3K-Akt signaling pathway
Focal adhesion

Related Products

LAMA5 Antibodies

LAMA5 Antibodies for Homo sapiens (Human)

LAMA5 Proteins

LAMA5 Proteins for Homo sapiens (Human)

LAMA5 ELISA Kit

LAMA5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.