Recombinant Human Laminin subunit gamma-1 (LAMC1), partial

Code CSB-YP1147HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP1147HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP1147HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP1147HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP1147HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Laminin subunit gamma-1; Laminin B2 chain; Laminin-1 subunit gamma; Laminin-10 subunit gamma; Laminin-11 subunit gamma; Laminin-2 subunit gamma; Laminin-3 subunit gamma; Laminin-4 subunit gamma; Laminin-6 subunit gamma; Laminin-7 subunit gamma; Laminin-8 subunit gamma; Laminin-9 subunit gamma; S-laminin subunit gamma; S-LAM gamma; LAMC1 LAMB2
Species
Homo sapiens (Human)
Expression Region
46-285
Target Protein Sequence
RPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGR
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Gene References into Functions
  1. Polymorphism in the ERalpha gene is associated with an increased risk for advanced Pelvic Organ Prolapse. However, polymorphism in the LAMC1 gene does not seem to be associated with such risk. PMID: 29241914
  2. We conclude that LAMC1 mRNA acts as a trans regulator to stimulate CD151 expression by competing for miR-124 binding in hepatocellular carcinoma cells. PMID: 28524360
  3. Further gene expression analyses demonstrated significantly higher expression of LAMC1 gene in colorectal cancer (CRC) tumor tissues than that in adjacent non-cancerous tissues (P = 0.0004). These findings strongly suggest that the functional SNP located at TFBSs, rs6695837 might contribute to CRC susceptibility, and the exact biological mechanism awaits further research. PMID: 28039327
  4. The rs780094 [1.34 (1.21-1.49); p = 8.57 x 10(-8) ] on chr 2 at the glucokinase regulatory protein (GCKR) locus was similarly significantly associated, while the rs10911205 [1.29 (1.16-1.44); p = 3.52 x 10(-6) ] on chr1 at the laminin subunit gamma-1 (LAMC1) locus showed suggestive association with disease. PMID: 27599772
  5. Our results show that miR-181a is down-regulated in glioblastoma multiforme (GBM) patients. The three target genes, ANGPT2, ARHGAP18 and LAMC1, are negatively correlated with the expression of miR-181a. Moreover, high expression of ANGPT2 or LAMC1 together with large size of GBM is correlated with a shorter median overall survival PMID: 27176932
  6. miR-506 acts as a tumor suppressor and inhibits malignancy of colorectal cancer cells through directly targeting LAMC1. PMID: 27993882
  7. Case Report: Anti-laminin-gamma 1 pemphigoid in patient with generalized pustular psoriasis and psoriasis vulgaris. PMID: 26074471
  8. The identification of laminin gamma 1 (LAMC1) and myeloid cell leukemia 1 (MCL1) as direct targets of miR-22 and miR-29a, respectively, suggested a tumor-suppressive role of these miRNAs. PMID: 26052614
  9. LAMC1 may contribute to the development and progression of uterine carcinoma, likely through enhancing tumor cell motility and invasion. PMID: 26343160
  10. Case Report: occurrence of anti-laminin-gamma1 pemphigoid in a case of autosomal recessive congenital ichthyosis. PMID: 24733442
  11. Data showed that LAMC1 expression is directly regulated by miR-29s. PMID: 24820027
  12. These findings document a pathogenic potential of antibodies targeting the laminin gamma1 N-terminus. PMID: 24300951
  13. carbohydrate moiety (alpha-Gal) on laminin gamma-1 and collagen alpha-1 (VI) chain are possibly common IgE-reactive proteins in the Japanese patients with beef allergy PMID: 24180678
  14. results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders PMID: 23674478
  15. LAMC1 polymorphism could be a protective factor for SLE. PMID: 23039241
  16. Results suggest that laminin gamma1 expression is associated with meningioma grades and could play a role in enhancing tumor invasion. PMID: 23053286
  17. Genetic polymorphism of LAMC1 gene is associated in the pathogenesis of colorectal cancers. PMID: 23266556
  18. Letter: a small but distinct subgroup of both systemic and cutaneous lupus erythematosus patients has antibodies against the C-terminus of laminin gamma1. PMID: 22968451
  19. Autoantibodies in anti-p200 pemphigoid sera are pathogenic while pathogenicity is not mediated by autoantibodies against laminin gamma1. PMID: 22911854
  20. Overexpression of laminin gamma1 immunoreactivity and alteration of its staining pattern may serve as a useful biomarker in serous tubal intraepithelial carcinoma. PMID: 22892598
  21. Mutations in the coding sequence of LAMC1 and DLGH1 may not be associated with Mayer-Rokitansky-Kuster-Hauser Syndrome. PMID: 22377151
  22. Single-nucleotide polymorphisms (SNPs) representing 99% coverage of LAMC1 were genotyped. There was no association between SNP rs10911193 and advanced pelvic organ prolapse. There was a trend toward significance for SNPs rs1413390, rs20563, and rs20558. PMID: 22342894
  23. LAMC1 is significantly associated with premature ovarian failure, and specifically, possession of at least one HT1 was associated with susceptibility to premature ovarian failure. PMID: 22321639
  24. Laminin-5 gamma2 chain and SPARC may play roles in the progression of esophageal squamous cell carcinoma and their simultaneous expression is correlated with poorer prognosis. PMID: 21192846
  25. The nano-structure of the laminin gamma-1 short arm was determined. In solution, it adapts an extended conformation. PMID: 20688161
  26. Several LAMC1 single nucleotide polymorphisms exist with significant differences between African American and Caucasian women, but no association found between any LAMC1 variant and advanced pelvic organ prolapse. PMID: 20223449
  27. Enhanced and specialized expression patterns of alpha 1 and gamma 1 laminins distinctly associate these two laminins with the Alzheimer disease. PMID: 12111806
  28. The neurite outgrowth domain of gamma 1 laminin accumulates heavily in the floor plate region, in the notochord and in GFAP-immunoreactive glial fibers of the embryonic spinal cord. PMID: 12526023
  29. Basement membrane formation is inhibited by a nidogen-laminin gamma1-chain fragment in skin-organotypic cultures. PMID: 15159456
  30. Expression of LAMC1 in glioblastoma is inhibited by indomethacin. Indomethacin inhibits cyclooxygenases and is an NSAID drug. PMID: 15561105
  31. a polymorphism in the promoter of LAMC1 may increase the susceptibility to early-onset pelvic organ prolapse PMID: 17021862
  32. gamma1 laminin is selectively overexpressed in reactive astrocytes of the amyotrophic lateral sclerosis spinal cord PMID: 17554784
  33. In embryonic stem cells deficient in laminins, due to lamc1 (laminin gamma1) deletion, vascular development and organization were largely unaffected. PMID: 18073332
  34. Laminin isoforms containing the gamma3 chain are unable to bind to integrins due to the absence of the glutamic acid residue conserved in the C-terminal regions of the gamma1 and gamma2 chains PMID: 18697739

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane.
Tissue Specificity
Found in the basement membranes (major component).
Database Links

HGNC: 6492

OMIM: 150290

KEGG: hsa:3915

STRING: 9606.ENSP00000258341

UniGene: Hs.609663

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×