Recombinant Human Leukocyte-specific transcript 1 protein(LST1)

Code CSB-EP013217HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. O00453
Relevance Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT
Research Area Cancer
Source E.coli
Gene Names LST1
Protein Names Protein B144
Expression Region 1-66aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.5 kDa
Protein Description Full Length of Isoform 10
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.
Subcellular Location Membrane, Single-pass membrane protein, Golgi apparatus membrane, Single-pass membrane protein, Endomembrane system, Single-pass membrane protein
Protein Families LST1 family
Tissue Specificity Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.
Database Links

HGNC: 14189

OMIM: 109170

KEGG: hsa:7940

UniGene: Hs.436066

Related Products

LST1 Antibodies

LST1 Antibodies for Homo sapiens (Human)

LST1 Proteins

LST1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.