Recombinant Human Leukocyte-specific transcript 1 protein(LST1)

Code CSB-EP013217HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names LST1
Uniprot No. O00453
Research Area Cancer
Alternative Names B144; B144 protein; D6S49E; Leucocyte specific transcript 1; Leukocyte-specific transcript 1 protein; Liver Specific Transporter; LIVTR; LST 1; Lst1; LST1_HUMAN; lymphocyte antigen 117; MGC119006; MGC119007; OTTHUMP00000029390; OTTHUMP00000029391; OTTHUMP00000029392; OTTHUMP00000029396; OTTHUMP00000029397; OTTHUMP00000029398; OTTHUMP00000038208; OTTHUMP00000038211; OTTHUMP00000038213; OTTHUMP00000038312; OTTHUMP00000038314; OTTHUMP00000038315; OTTHUMP00000038651; OTTHUMP00000038655; OTTHUMP00000038657; OTTHUMP00000166011; OTTHUMP00000166014; OTTHUMP00000166016; OTTHUMP00000166017; OTTHUMP00000166018; OTTHUMP00000166019; OTTHUMP00000215143; Protein B144
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-66aa
Target Protein Sequence MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 11.5 kDa
Protein Length Full Length of Isoform 10
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.
Gene References into Functions
  1. Increased expression of LST1 in GC-responders before therapy warrants further investigation into their role as potential predictors for the response to GC, and in the inflammatory process of rheumatoid arthritis. PMID: 27384923
  2. Data indicate that the MHC class III gene LST1 5' untranslated regions (5'-UTR) contains several upstream open reading frames (uORFs). PMID: 24816991
  3. Psoriasis was associated with promoter variant, rs9267502 of LST1.Promoter activity was examined and it was larger than that of the other genetic variants, most probably due to changes in binding affinity to transcription factors. PMID: 24803336
  4. This is the first report demonstrating regulated LST1 expression in human intestinal epithelial and microvascular endothelial cells and in inflamed colonic tissue from IBD patients. PMID: 24682411
  5. induces the formation of functional nanotubes PMID: 23239025
  6. LST1 is expressed specifically in leukocytes of the myeloid lineage, where it localizes to the tetraspanin-enriched microdomains andit binds SHP-1 and SHP-2 phosphatases. PMID: 22589543
  7. Study found association between extended LTA, TNF, LST1 and HLA gene haplotypes and rubella vaccine-induced immunity. PMID: 20668555
  8. Human dendritic cells activate resting natural killer (NK) cells and are recognized via the NKp30 receptor by activated NK cells. PMID: 11828009
  9. Expression of this receptor, inhibited by TGF-beta1, affects NK-mediated killing of dendritic cells PMID: 12646700
  10. The expression of LST1, specifically splice variants encoding soluble isoforms and NCR3, was increased in rheumatoid-arthritis-affected blood and synovium and was associated with more severe inflammation in the synovium. PMID: 16362817
  11. LST1 protein expression in human cell lines was found to be tightly regulated, allowing the expression of transmembrane isoforms but suppressing soluble isoforms PMID: 19663701

Show More

Hide All

Subcellular Location Membrane, Single-pass membrane protein, Golgi apparatus membrane, Single-pass membrane protein, Endomembrane system, Single-pass membrane protein
Protein Families LST1 family
Tissue Specificity Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.
Database Links

HGNC: 14189

OMIM: 109170

KEGG: hsa:7940

UniGene: Hs.436066

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1