Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

KDM3B

Uniprot No.

Q7LBC6

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

5qNCA; C5orf7; JHDM2B; JmjC domain containing histone demethylation protein 2B; JmjC domain-containing histone demethylation protein 2B; jmjd1b; Jumonji domain containing 1B; Jumonji domain containing protein 1B; Jumonji domain-containing protein 1B; KDM3B; KDM3B_HUMAN; KIAA1082; Lysine (K) specific demethylase 3B ; Lysine-specific demethylase 3B; NET22; Nuclear protein 5qNCA

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1498-1721aa

Target Protein Sequence

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

45.6kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human KDM3B contains amino acids 1498-1721. The calculated molecular weight for this KDM3B protein is 45.6 kDa. Expression of this KDM3B protein is conducted in e.coli. Fusion of the N-terminal 10xHis-SUMO tag and C-terminal Myc tag into the KDM3B encoding gene fragment was conducted, allowing for easier detection and purification of the KDM3B protein in subsequent stages.

Human lysine-specific demethylase 3B (KDM3B) is an epigenetic regulator that demethylates histones, specifically removing methyl groups from lysine 9 on histone H3. Its main function involves modulating chromatin structure, influencing gene expression, and participating in cellular processes like DNA repair and cell cycle regulation. In cancer research, KDM3B is implicated in tumorigenesis and metastasis. KDM3B may serve as a potential therapeutic target in cancer treatment. In stem cell biology, KDM3B influences cell fate decisions. Investigating KDM3B provides insights into epigenetic regulation, chromatin dynamics, and disease mechanisms. Understanding its multifaceted functions contributes to advancements in epigenetics, cancer biology, and stem cell research.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Surface Plasmon Resonance (SPR) analysis

Review: SPR measurements of the binding between JDM-7 and JMJD1C/JMJD1B. The sensorgrams of JDM-7 binding to the chip-immobilized partial JMJD1C and or JMJD1B proteins are expressed in RU (response unit) versus the time after subtracting the control signal.

By Anonymous

Code	CSB-EP759174HU
Abbreviation	Recombinant Human KDM3B protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage