Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial

In Stock
Code CSB-EP759174HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KDM3B
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
5qNCA; C5orf7; JHDM2B; JmjC domain containing histone demethylation protein 2B; JmjC domain-containing histone demethylation protein 2B; jmjd1b; Jumonji domain containing 1B; Jumonji domain containing protein 1B; Jumonji domain-containing protein 1B; KDM3B; KDM3B_HUMAN; KIAA1082; Lysine (K) specific demethylase 3B ; Lysine-specific demethylase 3B; NET22; Nuclear protein 5qNCA
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1498-1721aa
Target Protein Sequence
MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
45.6kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human KDM3B contains amino acids 1498-1721. The calculated molecular weight for this KDM3B protein is 45.6 kDa. Expression of this KDM3B protein is conducted in e.coli. Fusion of the N-terminal 10xHis-SUMO tag and C-terminal Myc tag into the KDM3B encoding gene fragment was conducted, allowing for easier detection and purification of the KDM3B protein in subsequent stages.

Human lysine-specific demethylase 3B (KDM3B) is an epigenetic regulator that demethylates histones, specifically removing methyl groups from lysine 9 on histone H3. Its main function involves modulating chromatin structure, influencing gene expression, and participating in cellular processes like DNA repair and cell cycle regulation. In cancer research, KDM3B is implicated in tumorigenesis and metastasis. KDM3B may serve as a potential therapeutic target in cancer treatment. In stem cell biology, KDM3B influences cell fate decisions. Investigating KDM3B provides insights into epigenetic regulation, chromatin dynamics, and disease mechanisms. Understanding its multifaceted functions contributes to advancements in epigenetics, cancer biology, and stem cell research.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Surface Plasmon Resonance (SPR) analysis

Review: SPR measurements of the binding between JDM-7 and JMJD1C/JMJD1B. The sensorgrams of JDM-7 binding to the chip-immobilized partial JMJD1C and or JMJD1B proteins are expressed in RU (response unit) versus the time after subtracting the control signal.

By Anonymous

Target Background

Function
Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.
Gene References into Functions
  1. we found that KDM3B exhibits potential tumor-suppressive activity and transcriptionally modulates HOXA1 expression via RARE in AML. PMID: 28540746
  2. H3K9 demethylase KDM3B represses transcription of the angiogenesis regulatory gene, ANGPT1. PMID: 25413303
  3. High expression of KDM3B and KDM5A is associated with a better prognosis (no recurrence after mastectomy p=0.005 and response to docetaxel p=0.005)in breast cancer patients. PMID: 23266085
  4. evidence that the H3K9-me1/2 demethylase KDM3B might play a role in leukemogenesis via activation of lmo2 through interdependent actions with the histone acetyltransferase complex containing CBP PMID: 22615488
  5. A novel nuclear protein, 5qNCA is a candidate for the myeloid leukemia tumor suppressor gene on chromosome 5 band q31. PMID: 11687974

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
JHDM2 histone demethylase family
Tissue Specificity
Ubiquitous. Highly expressed in placenta, skeletal muscle, kidney, heart and liver.
Database Links

HGNC: 1337

OMIM: 609373

KEGG: hsa:51780

STRING: 9606.ENSP00000326563

UniGene: Hs.483486

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*