Recombinant Human Lysine-specific demethylase 4A (KDM4A), partial

Code CSB-EP012137HU
Abbreviation Recombinant Human KDM4A protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
KDM4A
Uniprot No.
Research Area
Cancer
Alternative Names
JmjC domain-containing histone demethylation protein 3A;Jumonji domain-containing protein 2A;[histone H3]-trimethyl-L-lysine(36) demethylase 4A;[histone H3]-trimethyl-L-lysine(9) demethylase 4A
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-350aa
Target Protein Sequence
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate. Participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively.; Crucial for muscle differentiation, promotes transcriptional activation of the Myog gene by directing the removal of repressive chromatin marks at its promoter. Lacks the N-terminal demethylase domain.
Gene References into Functions
  1. MiR150 plays an important role in the development of lung cancer by serving as an oncogene via the SIRT2/JMJD2A signaling pathway. PMID: 29901178
  2. Data show that lysine demethylase 4 A/B double tudor domains (KDM4A/B DTDs) bind strongly to histone H3 (H3)K23me3. PMID: 27841353
  3. Generation of 2-hydroxyglutarate by mutated IDH1/2 leads to the activation of mTOR by inhibiting KDM4A. PMID: 27624942
  4. The present study indicates a novel evidence for JMJD2A in tumorigenesis by upregulating miR372 in liver cancer cells. PMID: 28467776
  5. JMJD2A regulated aerobic glycolysis by regulating LDHA expression. Therefore, the novel JMJD2A-LDHA signaling pathway could contribute to the Warburg effects in NPC progression. PMID: 28693517
  6. Findings inidicate a unique breast cancer stem-like cells (BCSC) culture system for drug screening and offer preclinical proof of concept for lysine demethylase 4A (KDM4A) inhibition as a new strategy to treat triple-negative breast cancer. PMID: 28883001
  7. The pyruvate dehydrogenase kinases (PDKs) PDK1 and PDK3 are direct targets of KDM4A and E2F1 and modulate the switch between glycolytic metabolism and mitochondrial oxidation. PMID: 27626669
  8. results suggest that KDM4A possesses the potential to act as an oxygen sensor in the context of chromatin modifications, with possible implications for epigenetic regulation in hypoxic disease states PMID: 28051298
  9. Here we show that JMJD2A, the first identified Jumonji C domain-containing histone demethylase, is the histone demethylase responsible for SUMO-2/3 enrichment on the Kaposi's sarcoma associated herpesvirus genome during viral reactivation PMID: 28212444
  10. Lgr4 activates Jmjd2a/AR signaling pathway to promote interaction AR with PSA promoter, causing reduction of prostate cancer apoptosis and cell cycle arrest. PMID: 27743893
  11. We demonstrate the previously unreported inhibitory action of PKF118-310 on KDM4A. Our findings open up the possibility of developing the first KDM4A-specific inhibitors and derivatives. PMID: 27767379
  12. KDM4A downregulation promotes autophagy in glioma cell lines. PMID: 27514525
  13. ERG promotes prostate tumorigenesis together with KDM4A through the upregulation of YAP1. A corollary is that KDM4A as well as YAP1 inhibitors may prove beneficial for the therapy of ERG-overexpressing prostate tumors. PMID: 27109047
  14. In pancreatic neoplasms, miR-137 targets KDM4A mRNA during Ras-induced senescence and activates both p53 and retinoblastoma (pRb) tumor suppressor pathways. PMID: 26904954
  15. Study demonstrates that JMJD2A contributes to tumorigenesis in non-small cell lung cancer (NSCLC) by regulating miR-150. Additionally, JMJD2A overexpression is associated with a poor prognosis for NSCLC patients. PMID: 26498874
  16. High KDM4A expression is associated with endometrial cancer progression. PMID: 26397136
  17. Studies indicate that histone lysine demethylase (JmjC-KDM) KDM4A protein has been implicated in numerous cancers and cardiovascular diseases. PMID: 25832587
  18. KDM4A is regulated by hsa-mir-23a-3p, hsa-mir-23b-3p, and hsa-mir-137. PMID: 26755726
  19. these data reveal a JMJD2A/ETV1/YAP1 axis that promotes prostate cancer initiation and that may be a suitable target for therapeutic inhibition. PMID: 26731476
  20. Results indicate that SCF(Fbxo22)-KDM4A is an E3 ubiquitin ligase that targets methylated p53 and regulates key senescent processes. PMID: 26868148
  21. This study showed that KDM4A interacts with RNA Polymerase I, associates with active ribosomal RNA genes and is required for serum-induced activation of rDNA transcription. PMID: 26729372
  22. Jra recruits the HP1a/KDM4A complex to its gene body region upon osmotic stress to reduce H3K36 methylation levels and disrupt H3K36 methylation-dependent histone deacetylation PMID: 25945750
  23. A coding single-nucleotide polymorphism in lysine demethylase KDM4A associates with increased sensitivity to mTOR inhibitors PMID: 25564517
  24. KDM4 mediates nutrient-limitation signaling that leads to the transcriptional induction of autophagy. PMID: 25660547
  25. this review focuses on describing the structure, mechanisms, and function of KDM4A and primarily discusses the role of KDM4A in cancer development and the importance of KDM4A as a potential therapeutic target. [review] PMID: 25633974
  26. Negative regulation of Sp1 by JMJD2A causes downregulation of Sp1 in highly invasive breast cancer cells. PMID: 25193278
  27. The data indicate that JMJD2A could promote breast cancer progression through transcriptional repression of the tumor suppressor ARHI. PMID: 24886710
  28. JMJD2A is a promoter of endometrial carcinoma cell proliferation and survival, and is a potential novel drug target. PMID: 24815446
  29. Those findings demonstrate that JMJD2A regulates gastric cancer growth and serves as an independent prognostic factor, and implicate that JMJD2A may be a promising target for intervention. PMID: 24802408
  30. Findings demonstrate that KDM4A overexpression results in site-specific copy gain of regions amplified in human tumors. PMID: 23871696
  31. analysis of the nickel-induced inhibition of truncated constructs of JMJD2A and JMJD2C histone demethylases using X-ray absorption spectroscopy PMID: 23692052
  32. JMJD2A regulation has a role in human carcinogenesis through regulation of the G(1)/S transition PMID: 23603248
  33. The expression of JMJD2A inhibits Ras-mediated CHD5 induction leading to a reduced activity of the p53 pathway. PMID: 23168260
  34. overexpression of JMJD2A may contribute to breast tumor formation by stimulating ERalpha activity and that JMJD2A may be a breast-relevant oncoprotein. PMID: 22948256
  35. data indicate that JMJD2A is a novel promoter of colon cancer cell proliferation and survival, which mediates its effects in p53-dependent and -independent ways PMID: 22134899
  36. JMJD2A gene could result in cell cycle change and proliferation inhibition, and lead to suppress tumor cell invasion and migration. PMID: 21962223
  37. JMJD2A and AR levels were significantly lower in malignant versus benign urothelium, while increased LSD1 levels were observed in malignant urothelium relative to benign; a significant reduction in all three proteins occurred with cancer stage progression PMID: 21400613
  38. SKP1-Cul1-F-box and leucine-rich repeat protein 4 (SCF-FbxL4) ubiquitin ligase regulates lysine demethylase 4A (KDM4A)/Jumonji domain-containing 2A (JMJD2A) protein PMID: 21757720
  39. these results demonstrate that SCF(FBXO22) regulates changes in histone H3 marks and cognate transcriptional control pathways by controlling KDM4A levels PMID: 21768309
  40. The expression of JMJD2A was upregulated in human hypertrophic cardiomyopathy patients. PMID: 21555854
  41. The authors show that knockdown of JMJD2A, an H3K9me3 demethylase, attenuates viral titers, whereas its overexpression increases Kaposi's sarcoma-associated herpesvirus reactivation. PMID: 21228229
  42. JHDM3A(GFP)(701) is a suitable catalytic module that can be targeted, under the control of a guide protein, to specific loci where the chromatin H3K9me3 status and the milieu of gene expression are to be modified. PMID: 21148561
  43. The ability of JMJD2A to associate with retinoblastoma proteins and histone deacetylase 1 implies an important role for this protein in cell proliferation and oncogenesis. PMID: 15927959
  44. JMJD2A selectively represses the expression of the achaete scute-like homologue 2 (ASCL2) gene but not other imprinted genes in the same imprinted locus in HeLa cells PMID: 16024779
  45. crystal structure of the double tudor domain of JMJD2A both in the presence and absence of a trimethylated H3-K4 peptide PMID: 16601153
  46. JHDM3A may function in euchromatin to remove histone methylation marks that are associated with active transcription PMID: 16732292
  47. identified two related histone demethylases, JMJD2A and JMJD2D PMID: 17555712
  48. how human JMJD2A, which is selective towards tri- and dimethylated histone H3 lysyl residues 9 and 36 (H3K9me3/me2 and H3K36me3/me2), discriminates between methylation states and achieves sequence selectivity for H3K9 PMID: 17589501
  49. Crystal structures of the JMJD2A catalytic domain in complex with H3K9me3, H3K36me2 and H3K36me3 peptides are presented. PMID: 17589523
  50. Human JMJD2A was expressed in undifferentiated and differentiated ES cells. PMID: 17611647

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
JHDM3 histone demethylase family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 22978

OMIM: 609764

KEGG: hsa:9682

STRING: 9606.ENSP00000361473

UniGene: Hs.155983

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*