Recombinant Human Lysyl oxidase homolog 4 (LOXL4)

Code CSB-YP846643HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP846643HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP846643HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP846643HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
LOXL4
Uniprot No.
Alternative Names
4833426I20Rik; FLJ21889; LOX L4; LOXC; LOXL 4; LOXL4; LOXL4_HUMAN; Lysyl oxidase homolog 4; Lysyl oxidase like 4; Lysyl oxidase like protein 4; Lysyl oxidase related C; Lysyl oxidase related protein C; Lysyl oxidase-like protein 4; Lysyl oxidase-related protein C
Species
Homo sapiens (Human)
Expression Region
570-756
Target Protein Sequence
DHMDWPYGYRRLLRFSTQIYNLGRTDFRPKTGRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May modulate the formation of a collagenous extracellular matrix.
Gene References into Functions
  1. study describes for the first time a direct link between a retinoic-induced gene and protein, LOXL4, and its general clinical pro-healing properties in ECM dynamics PMID: 27597564
  2. Although expression of LOXL4 is not statistically associated with neck metastases, we showed that LOXL4 expression significantly increased in laryngeal cancer. PMID: 26138381
  3. In hepatocellular carcinoma, low LOXL4 expression was associated with lower overall survival rates and higher cumulative recurrence rates. PMID: 26097573
  4. These results provide a set of the essential genes in this newly identified miR-193a-3p/LOXL4/Oxidative Stress axis. PMID: 25311867
  5. High Lysyl oxidase-like 4 promotes proliferation and metastasis of gastric cancer via FAK/Src pathway. PMID: 25216702
  6. data suggest that abnormal expression of LOXL4 of KCOT may enhance angiogenesis in KCOT, which may help to promote the locally aggressive biological behavior of KCOT. PMID: 24357854
  7. TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4). PMID: 23357697
  8. Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer. PMID: 22806361
  9. The human lysyl oxidase-like 4 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis. PMID: 21740577
  10. SNPs in the lysyl oxidase-like protein 4 and complement component 3 genes are associated with increased risk for endometriosis and endometriosis-associated infertility in a Puerto Rican population. PMID: 21733505
  11. Overexpression of the lysyl oxidase-like 4 gene is associated with metastatic head/neck carcinoma. PMID: 21115907
  12. The data presented in this work might emphasize the involvement of LOXL4 in molecular processes of the genesis or progression of head and neck carcinomas. PMID: 12894545
  13. LOXL4, with the four scavenger receptor cysteine rich domains, may also function as an active amine oxidase PMID: 14551188
  14. Up-regulation of lysyl oxidase mRNA and protein expression is associated with oral squamous cell carcinoma PMID: 17671119
  15. LOXL4-DC stimulated T cells produce higher IFN-gamma secretion compared to unstimulated T cells and T cells stimulated with untransfected DCs, in the presence of the pan-DR-epitope (PADRE) PMID: 18202753
  16. These results suggest that LOXL4 may function as a negative feedback regulator of TGF-beta1 in cell invasion by inhibiting the metabolism of extracellular matrix (ECM) components. PMID: 18586005
  17. Functional analysis of the 5' flanking domain of the LOXL4 gene in head and neck squamous cell carcinoma cells. PMID: 18949373
  18. In breast carcinoma, LOXL4 was expressed only in the effusion samples. In malignant mesothelioma, LOXL4 and its splice variants were expressed at all sites. PMID: 19015874

Show More

Hide All

Subcellular Location
Secreted, extracellular space.
Protein Families
Lysyl oxidase family
Tissue Specificity
Expressed in many tissues, the highest levels among the tissues studied being in the skeletal muscle, testis and pancreas. Expressed in cartilage.
Database Links

HGNC: 17171

OMIM: 607318

KEGG: hsa:84171

STRING: 9606.ENSP00000260702

UniGene: Hs.306814

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1