Recombinant Human M-phase inducer phosphatase 3 (CDC25C)

In Stock
Code CSB-EP004996HU
Abbreviation Recombinant Human CDC25C protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
CDC 25; Cdc 25C; CDC25; CDC25C; Cell division cycle 25 homolog C; Cell division cycle 25C; Cell division cycle 25C protein; Dual specificity phosphatase Cdc25C; M phase inducer phosphatase 3; M-phase inducer phosphatase 3; Mitosis inducer CDC25; MPIP3; MPIP3_HUMAN; Phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1, regulatory subunit 60
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-473aa
Target Protein Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 1-473 form the expressed segment for recombinant Human CDC25C. The calculated molecular weight for this CDC25C protein is 57.4 kDa. Expression of this CDC25C protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of CDC25C, making it easier to detect and purify the CDC25C recombinant protein in the later stages of expression and purification.

M-phase inducer phosphatase 3 (CDC25C) is an important protein in the area of cell cycle regulation. CDC25C plays a key role in controlling the cell division process, specifically during the transition from the G2 phase to the M phase. This makes CDC25C a central player in ensuring the accurate and timely progression of the cell cycle. In cancer research, CDC25C has gained prominence due to its involvement in promoting cell proliferation. Dysregulation of CDC25C is often observed in various cancers, where its overactivity can lead to uncontrolled cell division—a hallmark of cancer. Beyond cancer, CDC25C is implicated in studies related to reproductive biology. Its role in oocyte maturation and fertilization underscores its importance in fertility-related processes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Gene References into Functions
  1. Cells lacking ARID1A show enhanced AURKA transcription, which leads to the persistent activation of CDC25C, a key protein for G2/M transition and mitotic entry. PMID: 30097580
  2. FHL1 increase inhibitory CDC25 phosphorylation by forming a complex with CHK2 and CDC25, and sequester CDC25 in the cytoplasm by forming another complex with 14-3-3 and CDC25, resulting in increased radioresistance in cancer cells. PMID: 28094252
  3. CDC25A plays a novel role in regulating the malignant behavior of glioma stem cells as a part of Linc00152/miR-103a-3p/FEZF1/CDC25A axis. PMID: 28651608
  4. Overexpression of the CDK1 and CDC25A may have a role in the pathogenesis of the NFPA. PMID: 28004354
  5. Mdm2 overexpression and Cdc25C downregulation delay cell cycle progression through the G2/M phase. PMID: 28806397
  6. Xanthatin functions as a DNA-damaging agent in non-small cell lung carcinomas by activating Chk1-mediated DDR and lysosome-mediated degradation of Cdc25C. PMID: 29074359
  7. Myelodysplastic syndrome -related P95 point mutants of SRSF2 lead to alternative splicing of CDC25C in a manner that is not dependent on the DNA damage response. PMID: 27552991
  8. The aim of this review is to shed light on the role of four different phosphatases (PTEN, PP2A, CDC25 and DUSP1) in five different solid tumors (breast cancer, lung cancer, pancreatic cancer, prostate cancer and ovarian cancer), in order to better understand the most frequent and aggressive primary cancer of the central nervous system, glioblastoma. PMID: 28801478
  9. Data show that TRIB2-mediated degradation of CDC25C is associated with lysine-48-linked CDC25C polyubiquitination driven by the TRIB2 kinase-like domain. PMID: 27563873
  10. High expression of pCHK2-Thr68 was associated with decreased patient survival (p = 0.001), but was not an independent prognostic factor. Our results suggest that pCHK2-Thr68 and pCDC25C-Ser216 play important roles in breast cancer and may be potential treatment targets PMID: 27801830
  11. the biology of the activation/deactivation of CDC25 by kinases/phosphatases to maintain the level of CDK-cyclin activities and thus the genomic stability PMID: 27038604
  12. the knockdown of CDC25C can reduce both the radiotherapy sensitivity and the proliferation activity of EC9706 cells. PMID: 27188256
  13. results identify CDC25C as a downstream target of the mutated tyrosine kinase FLT3-ITD affecting cell-cycle regulation in a model of AML PMID: 27919943
  14. Suggest that the p53-p21-DREAM-CDE/CHR pathway regulates p53-dependent repression of Survivin, CDC25C, and PLK1 in HCT116 cells. PMID: 26595675
  15. These miR-142-3p functioned as a tumor suppressor by targeting CDC25C. PMID: 26805039
  16. Cdc25C negatively regulates proapoptotic ASK1 in a cell cycle-dependent manner and may play a role in G2/M checkpoint-mediated apoptosis. PMID: 25633196
  17. Recurrent CDC25C mutations drive malignant transformation in familial platelet disorder to acute myelogenous leukaemia. PMID: 25159113
  18. we conclude that inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through the transcriptional upregulation of CDC25C. PMID: 24626146
  19. These findings indicate that DHM inhibits the growth of hepatocellular carcinoma (HCC) cells via G2/M phase cell cycle arrest through Chk1/Chk2/Cdc25C pathway PMID: 24002546
  20. Purification and biochemical analysis of catalytically active human cdc25C dual specificity phosphatase PMID: 23567337
  21. protein plays a role in regulating PCa cell growth, and androgen treatments, but not EGF, greatly increase Cdc25C protein levels in AS PCa cells, which is in part by decreasing its degradation. PMID: 23637932
  22. dose-dependent Cdc25c phosphatase acts as an early G2-phase checkpoint, thus indicating mechanistic importance in the low-dose hyper-radiosensitivity and induced radioresistance transition PMID: 22843362
  23. data suggest that the maintenance of CDC25 activity does not fully rely on the thioredoxin reductase system in breast cancer cells, even in the presence of a major oxidative stress PMID: 22360685
  24. cloning and functional analysis of Cdc25C PMID: 22394631
  25. MMEQ induced G2/M arrest through the promotion of cdc25c in TSGH8301 cells. PMID: 22021033
  26. Inhibition of CK2 activity by three different inhibitors led to a down-regulation of the level of cdc25C. PMID: 21750987
  27. Two additional sites other than Ser216 in the widely studied cell division cycle (Cdc) protein 25C, whose function depends on 14-3-3 binding, were identified. PMID: 21189416
  28. The results show for the first time that in human mitosis, distinct phospho-isoforms of cdc25C exist with different localizations and interacting partners. PMID: 20668692
  29. ATM and Chk1/2 mediated phosphorylation of cdc25c plays a major role in cell cycle arrest induced by pectenotoxin2. PMID: 20514472
  30. CDC25C and phospho-CDC25C (Ser216) play a crucial role in the pathogenesis and/or progression of vulvar squamous cell carcinomas. PMID: 20500813
  31. Adventitious arsenate reductase activity of the catalytic domain of the human and Cdc25C phosphatases PMID: 20025242
  32. Analysis of cell cycle profile and cell cycle regulatory proteins indicated that arsenite arrested cell cycle at G(2)/M phase, partially through induction of cell division cycle 25 (Cdc25) isoform C (Cdc25C) degradation via ubiquitin-proteasome pathways PMID: 11842186
  33. results suggest that Plk1 phosphorylates Cdc25C on Ser198 and regulates nuclear translocation of Cdc25C during prophase PMID: 11897663
  34. role of degradation by oxidative stress in induction of cell cycle arrest PMID: 11925443
  35. Human CDC25B and CDC25C differ by their ability to restore a functional checkpoint response after gene replacement in fission yeast PMID: 12099692
  36. Ca2+ promotes erythrocyte band 3 tyrosine phosphorylation via dissociation of phosphotyrosine phosphatase from band 3. PMID: 12175337
  37. phosphorylation by Chk2 PMID: 12386164
  38. CDC25C is phosphorylated on Ser 214 during mitosis which, in turn, prevents phosphorylation of Ser 216. HeLa cells depeleted of endogenous CDC25C, when treated with exogenous CDC25C, had a substantial delay to mitotic entry. PMID: 12766774
  39. cdc25C not only plays a role at the G2/M transition but also in the modulation of DNA replication PMID: 12857880
  40. CDC25C translocation to the cell nucleus upon entry into mitosis is coordinated by Plk3 PMID: 14968113
  41. binding to VPR protein in human cell lines correlates with G2 arrest PMID: 14972559
  42. downregulation of Cdc25C is mediated by p53 via two independent mechanisms, one involving direct binding to the cdc25C promoter PMID: 15574328
  43. Vpr promotes cell cycle arrest at the G(2)/M phase by facilitating association of 14-3-3 and Cdc25C PMID: 15708996
  44. Vitamin C transiently arrests cancer cell cycle progression in S phase and G2/M boundary by modulating the kinetics of activation of CDC25C. PMID: 15887239
  45. Data suggests that CDC25C might play an important role in prostate cancer progression and could be used to monitor and predict the aggressiveness of this disease. PMID: 16000564
  46. Data suggest that Pim-1 activates Cdc25C by a direct phosphorylation and can thereby assume the function of a positive cell cycle regulator at the G2/M transition. PMID: 16356754
  47. Crystallization experiments of PLK1 protein in complex with an unphosphorylated and a phosphorylated target peptide from Cdc25C yield crystals suitable for X-ray diffraction analysis. PMID: 16582488
  48. These results demonstrate that the MAPK ERK signaling pathway contributes to the p53-independent antiproliferative functions of p14ARF. Furthermore, they identify a new mechanism by which phosphorylation at serine 216 participates to Cdc25C inactivation. PMID: 16582626
  49. Phosphorylation of cdc25c can be used to test whether a pharmacologic inhibitor of Plk1 would exert the same cellular effects as interference with Plk1 on an mRNA level. PMID: 16648550
  50. Chk1-mediated phosphorylation of Cdc25C plays a major role in response to LOR-mediated G(2)/M arrest. Although the Chk1-mediated cell growth arrest in a tumor cell line. PMID: 16649252

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
MPI phosphatase family
Database Links

HGNC: 1727

OMIM: 157680

KEGG: hsa:995

STRING: 9606.ENSP00000321656

UniGene: Hs.656

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*