Recombinant Human MIG7 (MIG7)

^{In Stock}

Code	CSB-EP2659HU
Abbreviation	Recombinant Human MIG7 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

MIG7

Uniprot No.

Q1AHR6

Research Area

Epigenetics and Nuclear Signaling

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-207aa

Target Protein Sequence

MAASRCSGLSEMTLLGSQAVSGLSSPLKSPCQVWNSPSPVCVCVCVCVCVCTRVHMRACSAGSAYLKQMKFCRMAASLDKVKKTDRGERGSCVSTTKRQASLSQRDIPSNNMKLATFPSDVNVESVAASLFFTVMKLGATQLEWNTKTPLGNTSSGFESQLYHSPAIDSEQDLSEVISSQSVETRLTSKVLKVEPESMNAKVFTFKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.3 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Constructing a plasmid that codes for the Human MIG7 protein (1-207aa) initiates the generation of the recombinant Human MIG7 protein. The constructed plasmid is transformed into 1-207aa cells. Positive e.coli cells are selected and then cultured under conditions that encourage the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis-SUMO tag. After that, affinity purification is employed to isolate and purify the recombinant MIG7 protein from the cell lysate. The purity of the resulting recombinant MIG7 protein is over 85%, determined by SDS-PAGE.