Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial

In Stock
Code CSB-EP621880HU
Abbreviation Recombinant Human MED1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
MED1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Activator-recruited cofactor 205 kDa component; ARC205; CRSP1; CRSP200; DRIP205; DRIP230; MED1; MED1_HUMAN; Mediator complex subunit 1; Mediator of RNA polymerase II transcription subunit 1; p53 regulatory protein RB18A; PBP; Peroxisome proliferator-activated receptor-binding protein; PPAR binding protein ; PPAR-binding protein; PPARBP ; PPARGBP; RB18A; Thyroid hormone receptor-associated protein complex 220 kDa component; Thyroid receptor-interacting protein 2; TR-interacting protein 2; Trap220; TRIP-2; TRIP2; Vitamin D receptor-interacting protein complex component DRIP205
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
878-1031aa
Target Protein Sequence
FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells.
Gene References into Functions
  1. High MED1 expression is associated with metastasis in breast Cancer. PMID: 29187405
  2. maintenance of the cancer cell state is dependent on recruitment of Mediator and Cohesin through FOXA and master transcription factors PMID: 27739523
  3. Data suggest that mediator complex subunit 1 (Med1/TRAP220) is a target for checkpoint kinase 2 (Chk2)-mediated phosphorylation and may play a role in cellular DNA damage responses by mediating proper induction of gene transcription upon DNA damage. PMID: 28430840
  4. In a cohort of youth at risk for bipolar disorder, pathway analysis showed an enrichment of the glucocorticoid receptor (GR) pathway with the genes MED1, HSPA1L, GTF2A1 and TAF15, which might underlie the previously reported role of stress response in the risk for bipolar disorder in vulnerable populations. PMID: 28291257
  5. modulation of ESR1-MED1 interactions by cAMP signaling plays a critical role in human decidualization. PMID: 26849466
  6. Our data indicate that MED1 serves as a key mediator in ARv567es induced gene expression PMID: 25481872
  7. Results show that miR-1 is downregulated in osteosarcoma cells but both of its targets Med1 and Med31 were overexpressed suggesting that MiR-1 plays an important role on the proliferation of osteosarcoma cells through regulation of Med1 and Med31. PMID: 24969180
  8. MED1 is required for optimal PRDM16-induced Ucp1 expression PMID: 25644605
  9. no association between SCZ and the SNPs of VDR, suggesting that VDR is not a major gene for SCZ in Chinese Han population. However, our data indicate a potential involvement of VDR SNPs in the susceptibility of risperidone-treated patients to MetS PMID: 24418047
  10. hyperactivated ERK and/or AKT signaling pathways promoted MED1 overexpression in prostate cancer cells. PMID: 23538858
  11. These results demonstrate a role for MED1 in mediating resistance to the pure anti-estrogen fulvestrant both in vitro and in vivo. PMID: 23936234
  12. multiple modes of the GATA1-MED1 axis may help to fine-tune GATA1 function during GATA1-mediated homeostasis events. PMID: 24245781
  13. Data concluded that those of VDR ff genotype may be regarded as "low responders" to vitamin D intake in terms of response of circulating 25(OH)D and certain inflammatory biomarkers. PMID: 23160722
  14. MiR-205 is an epigenetically regulated tumor suppressor that targets MED1. PMID: 22869146
  15. MED1 is recruited to the HER2 gene and required for its expression. PMID: 22964581
  16. Med1 (also known as PBP/RB18A/TRAP220/DRIP205) is a component of the human TRAP/Mediator complex that plays an important role in the transcriptional control of various genes PMID: 22342682
  17. functional communications between the MED1 subunit and the MED24-containing submodule that mediate estrogen receptor functions and growth of both normal mammary epithelial cells and breast carcinoma cells. PMID: 22331469
  18. Studies indicate that the activation domain of p53 (p53AD) binds directly to the MED17 subunit of Mediator, whereas the p53 C-terminal domain (p53CTD) binds the MED1 subunit. PMID: 21326907
  19. These results suggest that Mediator structural shifts induced by activator binding help stably orient pol II prior to transcription initiation within the human mediator-RNA polymerase II-TFIIF assembly. PMID: 22343046
  20. Regulation of androgen receptor-dependent transcription by coactivator MED1 is mediated through a newly discovered noncanonical binding motif. PMID: 22102282
  21. MED1 phosphorylation leads to ubiquitin-conjugating enzyme E2C (UBE2C) locus looping, UBE2C gene expression and cell growth in castration-resistant prostate cancer. PMID: 21556051
  22. establish ARGLU1 as a new MED1-interacting protein required for estrogen-dependent gene transcription and breast cancer cell growth. PMID: 21454576
  23. Vitamin D receptor rs2228570 polymorphism is associated with invasive ovarian carcinoma. PMID: 20473893
  24. The core subunit MED1 facilitates VDR activity and regulating keratinocyte proliferation and differentiation PMID: 20520624
  25. analysis of molecular mechanism of binding TRAP220 coactivator to Retinoid X Receptor alpha, activated by 9-cis retinoic acid PMID: 20398753
  26. analysis of mediator in three different structural states: bound to the activator SREBP-1a, VP16, or an activator-free state PMID: 20534441
  27. Results show that the cells of this aggressive form of breast cancer are genetically preprogrammed to depend on NR1D1 and PBP for the energy production necessary for survival. PMID: 20160030
  28. regulates p53-dependent apoptosis PMID: 11840331
  29. Interaction of PIMT with transcriptional coactivators CBP, p300, and PBP differential role in transcriptional regulation PMID: 11912212
  30. spermine significantly enhanced the interaction between HNF4alpha and full-length DRIP205 in an AF-2, NR-box-dependent manner. Spermine enhanced the interaction of DRIP205 with the VDR , but decreased the interaction of both HNF4alpha and VDR with GRIP1 PMID: 12089346
  31. TFIID and human mediator coactivator (TRAP220) complexes assemble cooperatively on promoter DNA PMID: 12130544
  32. there is a coregulatory role for subunits of this protein in androgen receptor-mediated gene expression PMID: 12218053
  33. examination of regulation by cellular signaling pathways PMID: 12356758
  34. extended LXXLL motif sequence determines the nuclear receptor binding specificity PMID: 12556447
  35. DRIP205 has a role as a coactivator of FXR PMID: 15187081
  36. DRIP205 coactivation of estrogen receptor alpha (ERalpha) involves multiple domains of both proteins PMID: 15471764
  37. RB18A plays a central role to control p53wt and p53mut protein content and functions in cells through a loop of regulation, which involves MDM2 PMID: 15848166
  38. MED1 exists predominantly in a TRAP/Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription. PMID: 15989967
  39. MED14 and MED1 are used by glucocorticoid receptor in a gene-specific manner, providing a mechanism for promoter selectivity by glucocorticoid receptor PMID: 16239257
  40. ERK-mediated phosphorylation is a regulatory mechanism that controls TRAP220/Med1 expression levels and modulates its functional activity. PMID: 16314496
  41. TRAP220/MED1 plays a novel coregulatory role in facilitating the recruitment of TRAP/Mediator to specific target genes involved in growth and cell cycle progression via GABP PMID: 16574658
  42. Med1 depleted cells exhibited an exacerbated response to retinoids, both in terms transcriptional responses and of cellular differentiation. PMID: 16723356
  43. Expression of TRAP220 mRNA and protein was shown to be decreased significantly in the temporal cortex of patients with epilepsy. PMID: 16934225
  44. Both DRIP205 and SRC-3 are required for the keratinocyte differentiation PMID: 17223341
  45. Recruitment of CBP and TRAP220 was diminished by the overexpression of a MED25 NR box deletion mutant, and by treatment with MED25 siRNA PMID: 17641689
  46. phosphorylation of RXRalpha at serine 260 impaired the recruitment of DRIP205 and other coactivators to the VDR.RXRalpha complex PMID: 18003614
  47. ERK-regulated site in Med1 protein is also essential for up-regulating interferon-induced transcription although not critical for binding to C/EBP-beta PMID: 18339625
  48. ERK phosphorylation of MED1 is a regulatory mechanism that promotes MED1 association with Mediator and, as such, may facilitate a novel feed-forward action of nuclear hormones PMID: 18391015
  49. Decreased MED1 transcript levels are observed in matched normal mucosa when compared with colorectal and ovarian cancers. PMID: 19127118
  50. a decrease of RB18A/MED1 expression in human melanoma cells increases their tumorigenic phenotype. PMID: 19243021

Show More

Hide All

Subcellular Location
Nucleus. Note=A subset of the protein may enter the nucleolus subsequent to phosphorylation by MAPK1 or MAPK3.
Protein Families
Mediator complex subunit 1 family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 9234

OMIM: 604311

KEGG: hsa:5469

STRING: 9606.ENSP00000300651

UniGene: Hs.643754

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*