Recombinant Human Metallothionein-1X (MT1X), partial

In Stock
Code CSB-EP015119HU
Abbreviation Recombinant Human MT1X protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MT1X
Uniprot No.
Research Area
Others
Alternative Names
MT1X; Metallothionein-1X; MT-1X; Metallothionein-IX; MT-IX
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-59aa
Target Protein Sequence
MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.9kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The DNA coding sequence translated into the human MT1X protein sequence (1-59aa) was fused with the N-terminal GST tag sequence to form the recombinant DNA, which was inserted into an expression vector. The reconstructed expression vector was transformed into the E.coli for follow-up expression. The product underwent purification to obtain the recombinant human MT1X protein with N-terminal GST tag. The SDS-PAGE analysis determined its purity higher than 90%. After electrophoresis, a 32 kDa protein band was observed on the gel.

MT1X is a gene encoding a protein named Metallothionein-1X (abbreviated MT1X) in human and belongs to Metallothionein superfamily. Metallothionein (MT) is a kind of metal-binding protein rich in cysteine and ubiquitous. It has important significance for maintaining the metabolic balance of some essential metals in the body, resisting toxic metal toxicity, and clearing free radicals. Human MT genes include 10 functional genes: MT1A, MT1B, MT1E, MT1F, MT1G, MT1H, MT1X, MT2A, MT3 and MT4. A study has shown that cells with high expression of MT1X have strong anti-apoptotic properties, which can induce cisplatin resistance in cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling.
Gene References into Functions
  1. Data show that in the MCF-7 breast cancer cell line, only MT1X metallothioneins (MTs) positively correlated with vascular endothelial growth factor C (VEGFC). PMID: 27107086
  2. MT1XT20 Single Quasi-Monomorphic Mononucleotide Marker showing Microsatellite Instability is associated with Persian Lynch Syndrome PMID: 27797228
  3. These findings suggest that functional interactions between FHL3 and MT-1X may provide some clues to the mechanisms of FHL3-regulated cell proliferation. PMID: 24690879
  4. Results show variation in MTX1 is implicated in disordered gambling PMID: 22780124
  5. siRNA-mediated knockdown of TCRP1 and MT1X was found to sensitize cells to cisplatin, leading to increased apoptosis and inhibition of cell proliferation PMID: 23251525
  6. Our results suggest that MT1XT20 represents a sensitive and specific marker for MSI testing and could be included in a complete set of MSI markers for the confident identification of familial or sporadic dMMR patients in colorectal cancers. PMID: 22108904
  7. It plays a role in the detoxification of heavy metals and reactive oxygen species. (review) PMID: 19881214

Show More

Hide All

Protein Families
Metallothionein superfamily, Type 1 family
Database Links

HGNC: 7405

OMIM: 156359

KEGG: hsa:4501

STRING: 9606.ENSP00000377995

UniGene: Hs.374950

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*