Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
MT1X; Metallothionein-1X; MT-1X; Metallothionein-IX; MT-IX
Species
Homo sapiens (Human)
Target Protein Sequence
MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The DNA coding sequence translated into the human MT1X protein sequence (1-59aa) was fused with the N-terminal GST tag sequence to form the recombinant DNA, which was inserted into an expression vector. The reconstructed expression vector was transformed into the E.coli for follow-up expression. The product underwent purification to obtain the recombinant human MT1X protein with N-terminal GST tag. The SDS-PAGE analysis determined its purity higher than 90%. After electrophoresis, a 32 kDa protein band was observed on the gel.
MT1X is a gene encoding a protein named Metallothionein-1X (abbreviated MT1X) in human and belongs to Metallothionein superfamily. Metallothionein (MT) is a kind of metal-binding protein rich in cysteine and ubiquitous. It has important significance for maintaining the metabolic balance of some essential metals in the body, resisting toxic metal toxicity, and clearing free radicals. Human MT genes include 10 functional genes: MT1A, MT1B, MT1E, MT1F, MT1G, MT1H, MT1X, MT2A, MT3 and MT4. A study has shown that cells with high expression of MT1X have strong anti-apoptotic properties, which can induce cisplatin resistance in cells.
