Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
(Demethylase)(DMTase)(Methyl-CpG-binding protein MBD2)
Species
Homo sapiens (Human)
Expression Region
143-411aa
Target Protein Sequence
ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human MBD2 was expressed with the amino acid range of 143-411. The theoretical molecular weight of the MBD2 protein is 45.2 kDa. This protein is generated in a e.coli-based system. The MBD2 coding gene included the N-terminal 6xHis-KSI tag, which simplifies the detection and purification processes of the recombinant MBD2 protein in following stages of expression and purification.
Methyl-CpG-binding domain protein 2 (MBD2) is a key epigenetic regulator that plays a crucial role in interpreting DNA methylation patterns in the genome. As a member of the MBD family, MBD2 specifically recognizes and binds to methylated CpG dinucleotides, influencing chromatin structure and gene expression. MBD2 is involved in gene silencing and transcriptional regulation by recruiting chromatin remodeling complexes and histone deacetylases to methylated DNA regions. It is implicated in various cellular processes, including embryonic development, genomic imprinting, and X-chromosome inactivation. Furthermore, MBD2 has been studied in the context of cancer, where alterations in DNA methylation patterns contribute to aberrant gene expression. Understanding the intricate functions of MBD2 provides insights into epigenetic mechanisms and their impact on cellular processes and disease.
