Recombinant Human Mitochondrial import inner membrane translocase subunit Tim8 A(TIMM8A)

Code CSB-EP023557HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O60220
Relevance Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Deafness dystonia protein 1 X-linked deafness dystonia protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Research Area Signal Transduction
Source E.coli
Gene Names TIMM8A
Protein Names Recommended name: Mitochondrial import inner membrane translocase subunit Tim8 A Alternative name(s): Deafness dystonia protein 1 X-linked deafness dystonia protein
Expression Region 1-97aa
Tag Info N-terminal GST-tagged
Mol. Weight 38.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development.
Involvement in disease Mohr-Tranebjaerg syndrome (MTS)
Subcellular Location Mitochondrion inner membrane, Peripheral membrane protein, Intermembrane side
Protein Families Small Tim family
Tissue Specificity Highly expressed in fetal and adult brain, followed by fetal lung, liver and kidney. Also expressed in heart, placenta, lung, liver, kidney, pancreas, skeletal muscle and heart.
Database Links

HGNC: 11817

OMIM: 300356

KEGG: hsa:1678

STRING: 9606.ENSP00000361993

UniGene: Hs.447877

Related Products

TIMM8A Antibodies

TIMM8A Antibodies for Homo sapiens (Human)

TIMM8A Antibodies for Human

TIMM8A Proteins

TIMM8A Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.