Recombinant Human Mitochondrial peptide methionine sulfoxide reductase (MSRA)

In Stock
Code CSB-EP883456HU
Abbreviation Recombinant Human MSRA protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MSRA
Uniprot No.
Research Area
Metabolism
Alternative Names
Cytosolic methionine S sulfoxide reductase ; Methionine sulphoxide reductase A; Mitochondrial peptide methionine sulfoxide reductase; MSR A; msrA; MSRA_HUMAN; peptide met (O) reductase; Peptide Met(O) reductase; Peptide methionine (S) S oxide reductase; Peptide-methionine (S)-S-oxide reductase; PMSR; Protein methionine S oxide reductase; Protein-methionine-S-oxide reductase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-235aa
Target Protein Sequence
GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Gene References into Functions
  1. Data show that miR-193b, by directly targeting focal adhesion kinase (FAK), CRK-like proto-oncogene (CRKL), and methionine sulfoxide reductase A (MSRA), regulates focal adhesion signaling and ROS signaling, which play pivotal roles in liposarcomagenesis and adipogenic differentiation. PMID: 28882999
  2. this study we have identified, for the first time, compounds structurally related to the natural products fusaricidins that markedly activate recombinant bovine and human MsrA and human MsrB. PMID: 26718410
  3. The association of MsrA haplotypes with executive functions indicated that MsrA is associated with executive function defects in bipolar I disorder patients. PMID: 26117066
  4. Silencing the expression of the main Msr elements-MsrA, MsrB1, or MsrB2 exacerbates sensitivity toward oxidative stress. PMID: 23988788
  5. ARD1 has a crucial role in the cellular response to oxidative stress as a bona fide regulator of MSRA. PMID: 25341044
  6. The functional MSRA rs10903323 G/A polymorphism is associated with coronary artery disease development. PMID: 23880405
  7. We hypothesize that the activity of MsrA can be employed as a marker for the isolation of stem and progenitor cell subpopulations for cell therapy applications. PMID: 23415806
  8. The MSRA rs10903323 G/A variant allele is associated with Rheumatoid Arthritis development, especially among male patients, older patients, C-Reactive Protein-positive patients, and anti-cyclic citrullinated peptide negative patients. PMID: 23244167
  9. The MSRA rs10903323 gene polymorphism may be implicated in the increased risk to develop cardiovascular events, in particular ischaemic heart disease, observed in rheumatoid arthritis patients. PMID: 22657383
  10. Mammalian and yeast MSRA reduced free methionine sulfoxide much more efficiently than MSRB. PMID: 22867795
  11. Data show that glutaredoxin acts as a reductant for methionine sulfoxide reductases A and B (MsrA and MsrB) with or without resolving cysteine. PMID: 22634633
  12. The haplotype with the lowest P value showed association with Meconium ileus in an independent sample of 1,335 unrelated cystic fibrosis patients PMID: 22438829
  13. The MSRA gene located on chromosome 8 was found to be associated with the phenotype of schizophrenia in Chinese first-episode schizophrenia patients. PMID: 21679298
  14. central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B PMID: 21674055
  15. Data suggest a critical role for TXNL6 in MsrA repair of essential lens proteins under oxidative stress conditions and that TXNL6 is important for MsrA defense protection against cataract. PMID: 21079812
  16. Our findings indicate that a novel association in the MSRA gene is related to oxidative stress and support the notion of a major role for this process in rheumatoid arthritis. PMID: 20617525
  17. reduction of MsrA levels results in increased cell proliferation and extracellular matrix degradation, and consequently in a more aggressive cellular phenotype in breast cancer cells PMID: 20937881
  18. Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20421936
  19. Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A PMID: 20368336
  20. protein-specific autoantibody are associated with pulmonary fibrosis and renal vascular damage in systemic sclerosis PMID: 19844733
  21. FOXO3a directly activates the human MsrA promoter in a cell culture system, implying that this could be a conserved mechanism of MsrA regulation. PMID: 19747232
  22. MSRA is down-regulated during cell aging. PMID: 14759519
  23. MsrA is present throughout the human lens, where it is likely to defend lens cells and their components against methionine oxidation PMID: 15199188
  24. The cloning and characterization of the 5' promoter region of human msrA are reported. PMID: 16162094
  25. MsrA may play an important role in cellular defenses against oxidative stress and in protection against death by limiting the accumulation of oxidative damage to proteins PMID: 16257642
  26. showed the expression and function of both sulfoxide reductases together with thioredoxin reductase in the cytosol as well as in the nucleus of epidermal melanocytes which are especially sensitive to reactive oxygen PMID: 16480945
  27. MSRA gene on chromosome 8p might possess metastasis suppressor activity in HCC. PMID: 17784942
  28. Methionine sulfoxide reductases A and B are seriously affected by hydrogen peroxide accumulation in acute vitiligo. PMID: 17943184
  29. this work points towards MSRA as a novel schizophrenia candidate gene PMID: 18506707
  30. Retinoic acid regulates transcription of MSRA gene via two distinct promoters via retinoic acid receptors. PMID: 18845237
  31. This suggests an important role for an MSRA catalytic antioxidant cycle for protection of the cytoplasmic compartment against oxidative damage. PMID: 19085252
  32. almost absent catalase and methionine sulfoxide reductase A and B protein expression in human gray/white scalp hair shafts in association with a functional loss of methionine sulfoxide repair in the entire gray hair follicle PMID: 19237503
  33. MSR enzymes are differentially expressed in human skin PMID: 19542914
  34. TFAP2B, LYPLAL1 and MSRA are associated with adiposity and fat distribution. PMID: 19557161
  35. Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19557161

Show More

Hide All

Subcellular Location
[Isoform 1]: Mitochondrion.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm. Nucleus.; [Isoform 5]: Cytoplasm. Membrane; Lipid-anchor.
Protein Families
MsrA Met sulfoxide reductase family
Tissue Specificity
Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
Database Links

HGNC: 7377

OMIM: 601250

KEGG: hsa:4482

STRING: 9606.ENSP00000313921

UniGene: Hs.490981

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*