Recombinant Human Monoglyceride lipase (MGLL)

Code CSB-EP013787HU
Abbreviation Recombinant Human MGLL protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
MGLL
Uniprot No.
Research Area
Cardiovascular
Alternative Names
EC 3.1.1.23; HU K5 ; HU-K5; HUK5 ; Lysophospholipase homolog; Lysophospholipase like; Lysophospholipase-like; MAGL; MGL; MGLL; MGLL_HUMAN; Monoacylglycerol lipase; Monoglyceride lipase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-303aa
Target Protein Sequence
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.3kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
Gene References into Functions
  1. Using a multimethod approach, the authors show that the dynamically relevant Trp-289 and Leu-232 residues serve as communication hubs within an allosteric protein network that controls signal propagation to the active site, and thus, regulates active-inactive interconversion of human MGL. PMID: 29379013
  2. RNA interference, specific pharmacological inhibitor JZL-184 and gene knock-in of MAGL were utilized to investigate the effects of MAGL on hepatocellular carcinoma (HCC) cell proliferation, apoptosis, and invasion. MAGL played important roles in both proliferation and invasion of HCC cells. PMID: 27767105
  3. This review summarizes the basics of monoglyceride metabolism and provides an overview on the therapeutic potential of MGL. [Review] PMID: 28213089
  4. MGLL may have a role in progression of gastrointestinal stromal tumors PMID: 27366945
  5. the upregulation of MAGL in hepatocellular carcinoma cells promoted cell growth and invasiveness abilities, and mediated epithelial-mesenchymal transition PMID: 27884159
  6. we clarify the key role of Phe159 and Ile179, two conserved residues within the lid domain, in regulating substrate specificity in MAGL. We conclude by proposing that other structurally related lipases may share this lid-domain-mediated mechanism for substrate specificity. PMID: 28088576
  7. the presence and differential distribution of fatty acid amide hydrolase (FAAH) and monoglyceride lipase (MGLL) in relation to CB1 during the maturation of human oocytes, was investigated. PMID: 26948343
  8. there was evidence that MGLL rs604300 genotype interacts with early life adversity to predict threat-related basolateral amygdala habituation, a neural phenotype linked to the endocannabinoid system and addiction PMID: 26595473
  9. This study unravels a novel mechanism of SND1 function and identifies MGLL as a unique tumor suppressor for HCC. MGLL might function as a homeostatic regulator of Akt restraining its activation. PMID: 26997225
  10. The data highlight specific inter-residue interactions within hMGL PMID: 26555264
  11. Monoacylglycerol lipase sulfenylation might act as an intrinsic neuroprotective mechanism by potentiating 2-AG signaling at CB1 receptors. PMID: 26000748
  12. Molecular dynamics and nudged elastic band simulations were used to explore the conformational transition pathway of the helix alpha4 of human monoacylglycerol lipase. PMID: 25078047
  13. role of monoacylglycerol lipase (MAGL) in the cancer progress PMID: 24633487
  14. Our findings establish that MAGL promotes metastases in nasopharyngeal carcinoma PMID: 25120746
  15. In subcutaneous adipose tissue, DAGL-a mRNA was upregulated and fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) mRNAs were down-regulated in obese subjects, but the diets had no influence. PMID: 24616451
  16. In obese humans, FAAH or MGL activity in adipocytes is not affected by diabetes, dyslipidaemia or other markers of metabolic dysfunction. PMID: 24593280
  17. Mutation of Cys242 was also found to impair inhibition of monoacylglycerol lipase. PMID: 24368842
  18. MGL interaction with a phospholipid membrane bilayer induces regional changes in the enzyme's conformation that favor its recruiting lipophilic substrate from membrane stores to the active site resulting in enhanced MGL catalytic activity. PMID: 23553709
  19. Data indicate that N,N-dimethyl-5-(4-phenoxyphenyl)-2H-tetrazole-2-carboxamide inhibited monoacylglycerol lipase (MAGL) with IC50 0.028 muM. PMID: 23455058
  20. MGL expression declines after peaking in infancy. PMID: 22827915
  21. results suggest that MGL plays a negative regulatory role in phosphatidylinositol-3 kinase/Akt signaling and tumor cell growth PMID: 22349814
  22. No association was found between our inflammatory bowel disease cohort and the candidate single nucleotide polymorphisms for MGL (CD/HC: P=0.37 and UC/HC: P=0.25). PMID: 22664939
  23. MAGL is elevated in androgen-independent versus androgen-dependent human prostate cancer cell lines, and pharmacological or RNA-interference disruption of this enzyme impairs prostate cancer aggressiveness. PMID: 21802006
  24. High MAGL is associated with colorectal cancer. PMID: 21543155
  25. Data present a high-resolution structure of a ligand-bound, soluble form of human monoglyceride lipase. PMID: 21308848
  26. One interval in the FAAH promoter and three intervals in the MGLL gene were associated with high BMI. PMID: 21118518
  27. Arachidonoylglycerol (2-AG) is the most abundant endocannabinoid in the brain and is believed to be hydrolyzed primarily by serine hydrolase monoacylglycerol lipase (MAGL) in a transgenic mouse model with targeted disruption of MAGL. PMID: 20855465
  28. Identification of an active site hydrogen bond network in human monoacylglycerol lipase. PMID: 20464001
  29. An apolar helix covering the active site also gives structural insight into the amphitropic character of MAGL, and likely explains how MAGL interacts with membranes to recruit its substrate. PMID: 19957260
  30. MGL shares the classic fold of the alpha/beta hydrolase family but depicts an unusually large hydrophobic occluded tunnel with a highly flexible lid at its entry and the catalytic triad buried at its end. PMID: 19962385
  31. Study shows that monoacylglycerol lipase (MAGL) is highly expressed in aggressive cancer cells and primary tumors; it regulates a fatty acid network enriched in oncogenic signaling lipids that promotes migration, invasion, survival, and tumor growth. PMID: 20079333
  32. not associated with susceptibility to alcoholism in a Japanese population. PMID: 17621164
  33. full proteomic characterization of hMGL was carried out, which showed (1) an absence of intramolecular disulfide bridges in the functional, recombinant enzyme and (2) the post-translational removal of the enzyme's N-terminal methionine PMID: 18452279
  34. Identification of amino acids critical to the catalytic activity PMID: 18721756
  35. Gene Ontology analysis indicated a significant alteration of oxygen transport (increased hemoglobin gene expression) and lipid metabolism [including monoglyceride lipase and low density lipoprotein receptor-related protein 5 (LRP5) gene]. PMID: 19233690

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein.
Protein Families
AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity
Detected in adipose tissue, lung, liver, kidney, brain and heart.
Database Links

HGNC: 17038

OMIM: 609699

KEGG: hsa:11343

STRING: 9606.ENSP00000265052

UniGene: Hs.277035

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*