Recombinant Human Mucin-7 (MUC7)

Code CSB-YP851529HU
Abbreviation Recombinant Human MUC7 protein
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MUC7
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
23-377aa
Target Protein Sequence
RERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
95.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-PDI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili.
Gene References into Functions
  1. The genotypic polymorphisms of IL-1beta -511 and +3954, and of MUC7 VNTR, had no direct associations with the development of BMS. However, the T allele of IL-1beta -511 may increase the risk of BMS by increasing psychological asthenia. PMID: 27246755
  2. High expression of MUC7 is associated with clear-cell renal cell carcinoma. PMID: 27683054
  3. A capsule-free mutant of S. pneumoniae TIGR4 binds to salivary proteins, most prominently to mucin MUC7, but that this binding was not mediated through PsrP or recognition of sialic acid. PMID: 26172471
  4. MUC7 glycosylation is altered in recurrent aphthous stomatitis. This may change the protective properties of this mucin against mucosal pathogens, which may effect this condition. PMID: 26051835
  5. Results identified a reduction in glycosylation of MUC7 in Sjogren's primarily due to the loss of the extended core 2 disialylated structure, with and without fucosylation and suggest that MUC7 O-glycan changes in Sjogren's Syndrome may alter the physical properties of saliva, leading to the symptom of dry mouth. PMID: 26631508
  6. The minimally invasive PTT procedure combined with Mucin 7 targeted GNPs is able to kill cancer cells and preserve healthy cells PMID: 25834826
  7. MUC7 is a salivary mucin with antimicrobial activity against bacteria and fungi. PMID: 12543672
  8. A significant increase in sulfation was identified in salivary MUC7 from rheumatoid arthritis patients. PMID: 23457413
  9. The study did not show a correlation between the MUC7 genotypes and caries. PMID: 22706105
  10. The present study did not disclose an association between MUC7*5/*6 and MUC7*6/*6 genotypes and gingival bleeding index. PMID: 23002673
  11. expression of different numbers of terminal repeats in this salivary mucin in the oral environment does not interfere with the etiopathogenesis of aggressive or chronic periodontitis PMID: 22167029
  12. MUC7 expression in ductal adenocarcinoma (DAC) and chronic pancreatitis was not statistically significant, but MUC7 could be considered as potential marker of malignant lesions, especially in pancreatic DAC, as it was positive in 73% of these cases. PMID: 21647207
  13. A novel MUC7*5-generated variable number of tandem repeat (VNTR) polymorphism decreases the likelihood of a diagnosis of asthma in an African American population. PMID: 19820409
  14. MUC5B and MUC7 from HIV patients, unlike the MUC5B and MUC7 from HIV negative individuals, did not inhibit HIV-1 activity. PMID: 20946627
  15. Structure and biosynthesis of human salivary mucins. PMID: 11996097
  16. Level of MG2 is lower in saliva of subjects with dental disease PMID: 12459324
  17. binds to Streptococcus mutans alpha-enolase [MG2] PMID: 15501816
  18. reported as new substrate for StcE protease of Escherichia coli O157-H7 in HEp-2 cells PMID: 15731026
  19. Interactions between mucin and non-mucin proteins in saliva could protect complex partners from proteolysis PMID: 16203048
  20. When the cells were treated with a panel of cytokines, epidermal growth factor, or a bacterial product (Pseudomonas aeruginosa lipopolysaccharide [LPS]), MUC7 transcripts and glycoprotein products were increased 1.7- to 3.2-fold. PMID: 16514118
  21. Data demonstrate that TNF-alpha activates MUC7 transcription via NF-kappaB signaling pathway. PMID: 16778149

Show More

Hide All

Involvement in disease
Asthma (ASTHMA)
Subcellular Location
Secreted.
Tissue Specificity
Expressed in salivary gland tissues and only in those that contain mucous acinar cells (e.g. sublingual and submandibular glands) and not in salivary glands containing only serous acinar cells (e.g. parotid gland).
Database Links

HGNC: 7518

OMIM: 158375

KEGG: hsa:4589

STRING: 9606.ENSP00000302021

UniGene: Hs.631946

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*