Recombinant Human Myelin protein P0 (MPZ), partial

Code CSB-YP014774HU
Abbreviation Recombinant Human MPZ protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MPZ
Uniprot No.
Research Area
Neuroscience
Alternative Names
Charcot Marie Tooth neuropathy 1B; CHM; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; CMTDID; DSS; HMSNIB; MPP; MPZ; Myelin peripheral protein; Myelin protein P0; Myelin protein zero; MYP0_HUMAN; P0
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
30-156aa
Target Protein Sequence
IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction.
Gene References into Functions
  1. The novel MPZ base-pair substitution in the family is associated with inherited distal demyelinating neuropathy and should be reclassified as pathogenic for Charcot-Marie-Tooth. PMID: 29465609
  2. In this Chinese Han population six novel Charcot-Marie-Tooth disease-associated gene mutations of MPZ (c.440T>C) was discovered. PMID: 27862672
  3. The obtained results depict that the protein with I30T mutation had variable structural conformation and dynamic behavior than native and mutant I30M of MPZ protein. PMID: 26135405
  4. interaction with neurofascins impaired by mutations D6Y, D32G, and H52Y responsible for late onset forms of the human disease PMID: 26406915
  5. Genotype of MPZ mutations and phenotype of Charcot Marie Tooth Disease are correlated. PMID: 26310628
  6. 2 heterozygous missense mutations were identified among 38 Italian CMT2 patients. PMID: 24819634
  7. P0 protein in serum may be an early effective biomarker for peripheral nerve neuropathy PMID: 24762602
  8. As a result of the haplotype analysis, based on ten markers (seven SNPs, two microsatellites and an intronic polyA stretch), the founder effect hypothesis for this allele migration is suggestive. PMID: 25720167
  9. This study demonistrated that The mutation c.419C>G of MPZ exhibited relatively late onset and slowly progressive CMT1 phenotype. PMID: 24028194
  10. This study showed that mutation of MPZ in patient with Charcot-Marie-Tooth disease. PMID: 23743332
  11. this mutation is especially important because it implicates the significance of the immunoglobulin-like structure of MPZ protein PMID: 22633464
  12. MPZ-related neuropathy should be considered in the diagnostic work up of patients with painful axonal neuropathy PMID: 23279346
  13. The p.Arg106Cys allele in MPZ causes late-onset predominantly axonal sensory and motor neuropathy. PMID: 22222859
  14. report of 2 siblings who presented with early onset severe Charcot-Marie-Tooth disease; a novel heterozygous C to T base substitution at neucleotide position 199 (c.199C>T) was identified in exon 2 of MPZ resulting in substitution of arginine for cysteine at codon 67 (p.Arg67Cys) PMID: 23197742
  15. Myelin protein zero is a key structural component of compact myelin, and over 100 mutations in this protein have been reported, which can give rise to neuropathies with either axonal, demyelinating, or other features encompassing a range of severity. PMID: 22704856
  16. Patients with CMT1B caused by Ser63del MPZ have a classical CMT1 phenotype that is much less severe than that of patients with Arg98Cys MPZ PMID: 22734905
  17. Thiss study demonistrated that two affected member of the same family with the same genotype had an 8-base pair deletion, c.160_167delTCCCGGGT in MPZ exon 2. PMID: 22622165
  18. Myelin protein P0 is a major Aire-regulated peripheral nervous system antigen demonstrating defective tolerance to P0 in both Aire-deficient mice and humans. PMID: 22490868
  19. L-MPZ, a novel isoform of myelin P0, is produced by stop codon readthrough. PMID: 22457349
  20. The overall frequency of MPZ mutation was 0.58% in a Greek population of Charcot-Marie-Tooth type 1. PMID: 22243284
  21. The new allelic variants of hereditary motor-sensor neuropathy caused by mutations in the MPZ (P0) gene are described. PMID: 22433810
  22. This study expanded the spectrum of the MPZ mutations and revealed two disparate mechanisms of MPZ mutations associated with a typical Charcot Marie Tooth 1b phenotype PMID: 22018721
  23. The crystal structure of the extracellular domain of human MPZ fused with maltose binding protein PMID: 21971831
  24. MPZ plays an important role in a family with 6 affected members in 3 consecutive generations, presenting with motor and sensory demyelinating polyneuropathy. PMID: 22275255
  25. Charcot-Marie-Tooth disease has been described in a large Norwegian family caused by a copy number variation in myelin protein zero. PMID: 21787890
  26. The identified mutation in MPZ may be the underlying cause of Charcot-Marie-Tooth disease in this family. PMID: 21503568
  27. we present here, for the first time, morphological data obtained in two sural nerve biopsies pointing to a hypomyelination-dysmyelination process in a family harboring the Pro132Leu mutation in the myelin protein zero gene PMID: 21107784
  28. a rare myelin protein zero (MPZ) variant alters enhancer activity in vitro and in vivo PMID: 21179557
  29. five patients with four novel MPZ mutations were identified by molecular genetic testing PMID: 20556410
  30. Cells expressing mutant P(0), as compared with those expressing wild-type P(0), demonstrated variable degrees of reduction in the cell adhesiveness PMID: 20461396
  31. two new MPZ mutations causing congenital hypomyelinating neuropathies; c.368_382delGCACGTTCACTTGTG (in-frame deletion of five amino acids) and c.392A>G, Asn131Ser PMID: 20621479
  32. Phenotypes associated with each of the new mutations include severe hereditary motor and sensory neuropathy type III, and mild phenotype CMT1B presented with only decreased or absent reflexes, foot deformities and mild or absent lower limb atrophies PMID: 20456450
  33. A novel frameshift mutation affecting the transmembrane domain (Leu144fs)in a patient with Charcot-Marie-Tooth disease presenting as with late-onset, remitting neurologic symptoms. PMID: 20516806
  34. Charcot-Marie-Tooth disease with intermediate conduction velocities caused by a novel mutation in the MPZ gene. PMID: 20544920
  35. The results of this study concluded that ARG98HIS MPZ mutation may cause hereditary and relatively mild and asymmetric demyelinating sensorimotor polyneuropathy PMID: 20215982
  36. The index patient of this family with unusual Charcot-Marie-Tooth phenotype is found to have a missense mutation within the intracellular domain of myelin protein zero. PMID: 19882637
  37. mutations in MPZ may have a role in Charcot-Marie-Tooth disease type 1B [case report] PMID: 19475438
  38. Here we describe an unusual presentation of the Val102fs mutation characterized by symptoms of spinal root hypertrophy with no overt peroneal muscular atrophy. This report adds new data concerning the clinical presentations of MPZ mutations. PMID: 19906531
  39. novel mutation in vocal cord paralysis PMID: 19950375
  40. Findings suggest that the clinical features associated with MPZ mutations depend partly on the nature of amino acid change. PMID: 19293842
  41. Data show that the CMT1Adup, GJB1, MPZ and PMP22 mutation frequencies were in the range of those described in other CMT patient collectives with different ethnical backgrounds. PMID: 19259128
  42. SSCP analysis for this gene in Croatian patients PMID: 12211648
  43. We suggest that axonal and demyelinating forms of CMT are not two distinct classes, but rather parts of a spectrum of genotypically related conditions, particularly with some MPZ mutations PMID: 12911457
  44. DNA sequencing analysis shows the Asn131Lys mutation in the myelin protein zero gene in three members of an affected family. PMID: 12940837
  45. This study demonstrates that autonomic disturbances may be one of the major clinical signs associated with CMT secondary to MPZ gene mutation in codon 124(thr124met mutation). PMID: 12948789
  46. A novel mutation, Thr65Ala, in the MPZ gene in a patient with Charcot-Marie-Tooth type 1B disease with focally folded myelin. PMID: 15036333
  47. Four missense mutations and one 4-base pair (bp) deletion, respectively, were identified in five patients, of which one mutation, c.173 T>A, has never been previously reported PMID: 15050444
  48. MPZ gene screening should be performed for wide phenotype spectrum of Charcot-Marie-Tooth disease. PMID: 15094849
  49. Chronic cough was associated with a Thr124 Met mutation. MPZ must be critical for maintenance of axonal function in addition to its role in myelin. All MPZ mutations associated with tonic pupils affect the same region of the extracellular domain. PMID: 15159512
  50. A novel Thr124Lys mutation in the MPZ gene is associated with congenital neuropathy with hypomyelination. PMID: 15184631

Show More

Hide All

Involvement in disease
Charcot-Marie-Tooth disease 1B (CMT1B); Charcot-Marie-Tooth disease 2I (CMT2I); Charcot-Marie-Tooth disease 2J (CMT2J); Adie pupil (ADIEP); Charcot-Marie-Tooth disease, dominant, intermediate type, D (CMTDID); Dejerine-Sottas syndrome (DSS); Neuropathy, congenital hypomyelinating or amyelinating (CHN); Roussy-Levy syndrome (ROULS)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform L-MPZ]: Myelin membrane; Single-pass type I membrane protein.
Protein Families
Myelin P0 protein family
Tissue Specificity
Found only in peripheral nervous system Schwann cells.
Database Links

HGNC: 7225

OMIM: 103100

KEGG: hsa:4359

STRING: 9606.ENSP00000431538

UniGene: Hs.591486

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*