Recombinant Human Myocilin (MYOC), partial

In Stock
Code CSB-MP859950HU1
Abbreviation Recombinant Human MYOC protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of MYOC was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
MYOC
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
241-504aa
Target Protein Sequence
GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secreted glycoprotein regulating the activation of different signaling pathways in adjacent cells to control different processes including cell adhesion, cell-matrix adhesion, cytoskeleton organization and cell migration. Promotes substrate adhesion, spreading and formation of focal contacts. Negatively regulates cell-matrix adhesion and stress fiber assembly through Rho protein signal transduction. Modulates the organization of actin cytoskeleton by stimulating the formation of stress fibers through interactions with components of Wnt signaling pathways. Promotes cell migration through activation of PTK2 and the downstream phosphatidylinositol 3-kinase signaling. Plays a role in bone formation and promotes osteoblast differentiation in a dose-dependent manner through mitogen-activated protein kinase signaling. Mediates myelination in the peripheral nervous system through ERBB2/ERBB3 signaling. Plays a role as a regulator of muscle hypertrophy through the components of dystrophin-associated protein complex. Involved in positive regulation of mitochondrial depolarization. Plays a role in neurite outgrowth. May participate in the obstruction of fluid outflow in the trabecular meshwork.
Gene References into Functions
  1. Structure and misfolding of the flexible tripartite coiled-coil domain of glaucoma-associated myocilin has been reported. PMID: 29056483
  2. single nucleotide polymorphism in exon 3 of MYOC is associated with glaucoma. PMID: 29630620
  3. Juvenile onset open angle glaucoma and adult onset POAG form a spectrum of phenotypes. we analyzed the common variants in MYOC and CYP1B1 that were shared among all the three phenotypes .An interesting finding was that, while, many CYP1B1 variants were found in all three types of glaucoma, there was no reported MYOC variant, that was common to all the three primary glaucomas. PMID: 27779752
  4. We report a five-generation pedigree with a complex pattern of primary open angle glaucoma(POAG) inheritance; familial clustering of POAG in this pedigree is consistent with dominant inheritance of a glaucoma-causing gene, mutations were not detected in genes previously associated with autosomal dominant glaucoma, suggesting the involvement of a novel disease-causing gene in this pedigree. PMID: 27355837
  5. present work reveals that FOXC1 is an important regulator of exocytosis and establishes a new link between FOXC1 and MYOC-associated glaucoma PMID: 28575017
  6. The four detected MYOC mutations appeared to be associated with morphologic changes in the trabecular meshwork and the underlying pathogenesis of a subtype of familial primary open angle glaucoma. PMID: 28564705
  7. The mutations c.1456C < T (p.L486F) in MYOC and c.322G < A (p.V108I) in B4GALT3 are likely responsible for the pathogenesis of Primary Open-angle Glaucoma in this family. PMID: 27900994
  8. Our findings demonstrated that MYOC cascade genetic testing for POAG allows identification of at-risk individuals at an early stage or even before signs of glaucoma are present. To our knowledge, this is the first study to demonstrate the clinical utility of predictive genetic testing for MYOC glaucoma. PMID: 27993484
  9. The significance of this finding is that higher numbers of healthy individuals in the population are expected to be carriers of this mutation, which in turn reduces the utility of identifying carriers of this mutation as a screening tool for glaucoma PMID: 28038983
  10. regulation by retinoic acid acts through the MYOC promoter which contains a critical cluster of four retinoic acid responsive elements (RAREs), with the RARE-DR2 presenting the strongest effect and binding the RARalpha/RXRalpha heterodimer. PMID: 28153738
  11. Five out of 30 families with PCG (16.7%) had disease attributable to CYP1B1 alterations suggesting that CYP1B1 is not the major gene causing PCG in Vietnamese unlike in the case of Arab or Romany patients. PMID: 26550974
  12. The present study provides insight into the genetic or haplotype variants of MYOC and OPTN genes contributing to primary glaucoma. Haplotype variants identified in the present study may be regarded as potential contributing factors of primary glaucoma in Korea. PMID: 27485216
  13. Familial linkage studies for primary angle-closure glaucoma have been performed and identified MYOC causative primary angle-closure glaucoma disease PMID: 26497787
  14. The rate of CYP1B1 mutations in Lebanese patients with primary congenital glaucoma (PCG) is lower than that reported in other Arab and Middle Eastern populations and suggests other genes are responsible. PMID: 24940937
  15. Data show that predictive genetic testing for early onset Myocilin glaucoma can facilitate early detection of disease or discharge from routine ophthalmic examinations. PMID: 25582056
  16. This study does not confirm a role for genetic variants in the MYOC, NR3C1 and FKBP5 genes in the pathogenesis of corticosteroid-induced ocular hypertension. PMID: 24417561
  17. Glaucomatous MYOC mutations activate the IL-1beta/NF-kappaB inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells. PMID: 26396484
  18. Secondary structure prediction of the Ser341Pro MYOC gene mutation suggested that the MYOC protein was misfolded. PMID: 25777973
  19. Mutations in myoc ofactomedin domain are causative in the autosomal dominant inherited form of the prevalent ocular disorder glaucoma. PMID: 25524706
  20. A novel heterozygous missense mutation c.761CPMID: 26095806
  21. All POAG samples underwent full sequencing of the MYOC gene, and we found a sensitivity of 100%, specificity of 99.91%, positive predictive value of 95.65%, and negative predictive value of 100% between imputation and sequencing. PMID: 26237198
  22. FAs, expression of fibrogenic markers, and myocilin in HTM cells. These characteristics of Hic-5 in TM cells indicate its importance in regulation of AH outflow through the TM in both normal and glaucomatous eyes. PMID: 26313302
  23. Haplotype analysis of association of the MYOC gene with primary angle-closure glaucoma in a Han Chinese population PMID: 25268471
  24. Overall, 3.3% of black South Africans with POAG have a Gly374Val or Tyr453del MYOC mutation. The Tyr453del mutation is incompletely penetrant. PMID: 25330346
  25. The interaction of Grp94 with myocilin aggregates can be manipulated by cellular environment and genetics; this process can be exploited with Grp94 inhibitors to promote the clearance of toxic forms of myocilin. PMID: 25027323
  26. TGF-beta2 induced MYOC expression and secretion in human primary cultured trabecular meshwork cells PMID: 25197353
  27. According to molecular genetic studies, MYOC causative gene involved in the development of Primary open-angle glaucoma. PMID: 25711070
  28. The data suggest that the DEX-induced increase in MYOC expression activates a calcineurin and NFATc1 pathway in a calcium independent mechanism. PMID: 25450062
  29. MYOC mutations are associated with primary open-angle glaucoma . PMID: 24406458
  30. found no evidence to support a significant association between MYOC polymorphism and hgih myopia PMID: 24766640
  31. The current study provided evidence that in normal homeostatic situation, the turnover of endogenous myocilin involves ubiquitin-proteasome and lysosomal pathways. PMID: 24732711
  32. The Asn480Lys mutation and the IVS2 730+35 G>A polymorphism increased susceptibility to juvenile-onset open angle glaucoma in this large Malay pedigree. PMID: 24883016
  33. the novel heterozygous single nucleotide transition MYOC:c.1119G>A, p.(Trp373), predicted to encode an aberrant truncated MYOC protein in two siblings affected by autosomal dominant primary open angle glaucoma PMID: 24768183
  34. This study demonistrated that myocilin as a novel positive regulator of oligodendrocyte differentiation in the optic nerve. In the absence of myocilin, oligodendrocyte differentiation is delayed in vivo. PMID: 24741044
  35. The glaucoma-associated olfactomedin domain of myocilin forms polymorphic fibrils that are constrained by partial unfolding and may contribute to glaucoma pathogenesis. PMID: 24333014
  36. myocilin promotes cell proliferation and resistance to apoptosis via the ERK1/2 MAPK signaling pathway. PMID: 24563482
  37. The study showed that the peptide DQLETQTRELETAYSNLLRD corresponding to N-terminal Leucine zipper motif (LZM) of the protein is able to form amyloid-like fibrils. PMID: 23764838
  38. This is the largest TM expression study of POAG cases and controls performed to date and represents the first report of TM expression in a patient having POAG with a Q368X MYOC mutation. PMID: 24003086
  39. A novel severe Juvenile Open Angle Glaucoma disease causing mutation in the MYOC gene. PMID: 23886590
  40. Our results using human patient samples are consistent with a dominant-negative effect of pathogenic MYOC mutations on myocilin secretion. PMID: 23517641
  41. Myocilin also stimulated osteogenic differentiation of wild-type MSCs, which was associated with activation of the p38, Erk1/2, and JNK MAP kinase signaling pathways PMID: 23629661
  42. The prevalence of Myocilin mutations in glaucoma cases with severe visual field loss is significantly greater than in nonadvanced glaucoma patients. PMID: 23453510
  43. The in-frame MYOC c.1187_1188insCCCAGA mutation causes juvenile-onset open-angle glaucoma in a Brazilian family. PMID: 23566828
  44. Compound heterozygote for the Gln368STOP and Thr377Met MYOC mutations has been described in a pedigree with high prevalence of primary open-angle glaucoma. PMID: 23304066
  45. This study analyzed CYP1B1, LTBP2, and MYOC mutations in a cohort of primary congenital glaucoma patients from the United States, applying whole exome sequencing PMID: 23218701
  46. Grp94 triages mutant myocilin through endoplasmic reticulum-associated degradation. PMID: 23035116
  47. The glaucoma-associated olfactomedin domain of myocilin is a novel calcium binding protein. PMID: 23129764
  48. Mutant CYP1B1, lacking the 17beta estradiol metabolizing activity, can cause MYOC upregulation, which might have a potential implication in glaucoma pathogenesis. PMID: 23028769
  49. There is strong evidence that myocilin polymorphisms are associated with primary open-angle glaucoma susceptibility. [Meta-analysis] PMID: 23029558
  50. CYP1B1 may act as a modifier of MYOC expression and a mutation in both genes was related to the early onset of juvenile open angle glaucoma. PMID: 22942166

Show More

Hide All

Involvement in disease
Glaucoma 1, open angle, A (GLC1A); Glaucoma 3, primary congenital, A (GLC3A)
Subcellular Location
Secreted. Golgi apparatus. Cytoplasmic vesicle. Secreted, extracellular space. Secreted, extracellular space, extracellular matrix. Secreted, extracellular exosome. Mitochondrion. Mitochondrion intermembrane space. Mitochondrion inner membrane. Mitochondrion outer membrane. Rough endoplasmic reticulum. Cell projection. Cell projection, cilium.; [Myocilin, C-terminal fragment]: Secreted.; [Myocilin, N-terminal fragment]: Endoplasmic reticulum. Note=Remains retained in the endoplasmic reticulum.
Tissue Specificity
Detected in aqueous humor. Detected in the eye (at protein level). Widely expressed. Highly expressed in various types of muscle, ciliary body, papillary sphincter, skeletal muscle, heart, and bone marrow-derived mesenchymal stem cells. Expressed predomin
Database Links

HGNC: 7610

OMIM: 137750

KEGG: hsa:4653

STRING: 9606.ENSP00000037502

UniGene: Hs.436037

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*