Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial

Code CSB-RP053854h
Abbreviation Recombinant Human NDUFV2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
24kDa subunit of Complex I; CI-24k; complex I 24kDa subunit; complex I, mitochondrial respiratory 2; mitochondrial; NADH dehydrogenase (ubiquinone) flavoprotein 2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase [ubiquinone] flavoprotein 2; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH ubiquinone oxidoreductase 24 kDa subunit ; NADH-ubiquinone oxidoreductase 24 kDa subunit; NADH-ubiquinone oxidoreductase flavoprotein 2; NDUFV2; NDUV2_HUMAN; nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit; Ubiquinoneflavoprotein 2; Ubiquinoneflavoprotein 2, mitochondrial precursor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
35-249aa
Target Protein Sequence
GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.6kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Gene References into Functions
  1. haplotype T-C consisting of rs12457810 and rs12964485 in the 5'-upstream region of NDUFV2 may be a protective factor for the development of MDD in Han Chinese PMID: 26544616
  2. We have identified NDUFV2 mutations in two families with Complex I deficiency, including a novel mutation. PMID: 26008862
  3. The results show mitochondrial haplotypes associated with polymorphism of this gene are associated with elite middle and sprint power endurance in Japanese athletes PMID: 20551160
  4. There is no statistical significance between NDUFV2 gene promoter variants and susceptibility to schizophrenia in Han Chinese. PMID: 21190551
  5. The mitochondrial targeting sequence of NDUFV2 is located at the N-terminus of the precursor protein. Impairment of mitochondrial localization of NDUFV2 as a mechanistic basis for early-onset hypertrophic cardiomyopathy and encephalopathy was established. PMID: 21548921
  6. Three single nucleotide polymorphisms in the NDUFV2 gene, were studies in bipolar disorder pateints and controls. PMID: 20978456
  7. Our findings suggest further studies addressing the role of NDUFV2 variation in Parkinson's disease may be warranted. PMID: 20971673
  8. mutation causes early onset hypertrophic cardiomyopathy and encephalopathy PMID: 12754703
  9. Polymorphisms of this gene may be one of the genetic risk factors for bipolar disorder. PMID: 12815743
  10. Polymorphisms in the promoter region of NDUFV2 are a genetic risk factor for bipolar disorder. The association of the haplotypes -602G> A and -3542G> A polymorphisms with bipolar disorder was seen both in Japanese case-control samples and NIMH trios. PMID: 15450783
  11. NDUFV2 individual genotypes were not associated with schizophrenia, but the haplotype consisting of the two single nucleotide polymorphisms were significantly associated with schizophrenia. PMID: 16508936
  12. genetic variants of NDUFV2 may increase risk for bipolar disorder. PMID: 18199248
  13. This study found that the expressions of NDUFV2 were up-regulated in those from patients with Japanese bipolar II disorder and the mRNA levels of this gene were down-regulated in Caucasian schizophrenia. PMID: 19135101
  14. Data show that the haplotype consisting of rs6506640 (-342G > A) and rs906807 (86C > T) on the mitochondrial gene NDUFV2 is found to be associated with bipolar disorder. PMID: 19194776

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Protein Families
Complex I 24 kDa subunit family
Database Links

HGNC: 7717

OMIM: 600532

KEGG: hsa:4729

STRING: 9606.ENSP00000327268

UniGene: Hs.464572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*