Recombinant Human NHP2-like protein 1(NHP2L1)

Code CSB-YP015794HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P55769
Relevance Binds to the 5'-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assbly. The protein undergoes a conformational change upon RNA-binding.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias High mobility group-like nuclear protein 2 homolog 1OTK27SNU13 homolog ;hSNU13U4/U6.U5 tri-snRNP 15.5 kDa protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Research Area Transcription
Source Yeast
Gene Names SNU13
Protein Names Recommended name: NHP2-like protein 1 Alternative name(s): High mobility group-like nuclear protein 2 homolog 1 OTK27 SNU13 homolog Short name= hSNU13 U4/U6.U5 tri-snRNP 15.5 kDa protein
Expression Region 2-128aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.
Subcellular Location Nucleus, nucleolus
Protein Families Eukaryotic ribosomal protein eL8 family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 7819

OMIM: 601304

KEGG: hsa:4809

STRING: 9606.ENSP00000215956

UniGene: Hs.182255

Related Products

SNU13 Antibodies

SNU13 Antibodies for Homo sapiens (Human)

SNU13 Proteins

SNU13 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.