Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
D14S46E; Neural retina-specific leucine zipper protein; Neural retinal specific leucine zipper; NRL; NRL MAF; NRL_HUMAN; RP27
Species
Homo sapiens (Human)
Expression Region
1-237aa
Target Protein Sequence
MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human NRL was expressed with the amino acid range of 1-237. The expected molecular weight for the NRL protein is calculated to be 33.4 kDa. This NRL recombinant protein is manufactured in e.coli. The NRL coding gene included the N-terminal 10xHis tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant NRL protein in following stages of expression and purification.
The human neural retina-specific leucine zipper protein (NRL) is a transcription factor that plays a crucial role in the development and maintenance of photoreceptor cells in the retina. NRL is predominantly expressed in rod photoreceptors and is involved in the regulation of genes associated with rod cell differentiation and function. It promotes the development of rod photoreceptors while suppressing the formation of cone photoreceptors. NRL is essential for the proper functioning of the visual system, as it contributes to the synthesis of visual pigments and the overall sensitivity of rod cells to light. Research areas related to NRL include retinal development, visual neuroscience, and potential implications for retinal diseases and therapies. Understanding NRL's role provides insights into the molecular mechanisms governing vision and may contribute to the development of treatments for retinal disorders.
