Recombinant Human Neural retina-specific leucine zipper protein (NRL)

In Stock
Code CSB-EP016086HU
Abbreviation Recombinant Human NRL protein
MSDS
Size $306
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP016086HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP016086HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
NRL
Uniprot No.
Research Area
Others
Alternative Names
D14S46E; Neural retina-specific leucine zipper protein; Neural retinal specific leucine zipper; NRL; NRL MAF; NRL_HUMAN; RP27
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-237aa
Target Protein Sequence
MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human NRL was expressed with the amino acid range of 1-237. The expected molecular weight for the NRL protein is calculated to be 33.4 kDa. This NRL recombinant protein is manufactured in e.coli. The NRL coding gene included the N-terminal 10xHis tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant NRL protein in following stages of expression and purification.

The human neural retina-specific leucine zipper protein (NRL) is a transcription factor that plays a crucial role in the development and maintenance of photoreceptor cells in the retina. NRL is predominantly expressed in rod photoreceptors and is involved in the regulation of genes associated with rod cell differentiation and function. It promotes the development of rod photoreceptors while suppressing the formation of cone photoreceptors. NRL is essential for the proper functioning of the visual system, as it contributes to the synthesis of visual pigments and the overall sensitivity of rod cells to light. Research areas related to NRL include retinal development, visual neuroscience, and potential implications for retinal diseases and therapies. Understanding NRL's role provides insights into the molecular mechanisms governing vision and may contribute to the development of treatments for retinal disorders.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.
Gene References into Functions
  1. that two photoreceptor-specific transcription factors, NRL and CRX, are master regulators of this program and are required for tumor maintenance in this subgroup PMID: 29533784
  2. We identified a novel NRL mutation (c.147_149del, p.Ser50del) leading to adRP in a Chinese family with retinitis pigmenntosa. PMID: 28106895
  3. investigated the prevalence of the NRL mutation among Bukhara Jews with oculopharyngeal muscular dystrophy (OPMD) PMID: 28590779
  4. This report expands the spectrum of NRL recessive mutations, as well as the genetic spectrum of ESCS, and indicates a new syndrome of OPMD with an ESCS-like phenotype. PMID: 27732723
  5. The c.146 C>T mutation in NRL gene causes autosomal dominant retinitis pigmentosa for this family. PMID: 27081294
  6. In another family a variant, p.M96T in the NRL gene was detected as a retinitis pigmentosa-causing mutation. PMID: 23534816
  7. This novel p.M96T mutant activated the RHO promoter more intensely than did wild-type NRL in a family with autosomal dominant retinitis pigmentosa. PMID: 21981118
  8. Studies suggest an important role of sumoylation in fine-tuning the activity of NRL and thereby incorporating yet another layer of control in gene regulatory networks involved in photoreceptor development and homeostasis. PMID: 20551322
  9. In this study, NR2E3 mutations were found to be responsible for approximately 2.9% of overall retinitis pigmentosa (RP) in Chinese patients, NRL was not associated with RP. PMID: 19933183
  10. The disease caused by NRL mutations found in this study appears to be more severe PMID: 11879142
  11. Mutation screening of patients with Leber Congenital Amaurosis or the enhanced S-Cone Syndrome reveals a lack of sequence variations in the NRL gene. PMID: 12552256
  12. the function of NRL is modulated by its interaction with specific repressor proteins, related to cross-talk between signaling pathways in the retina PMID: 12566383
  13. The NRL Ser50Thr mutation is associated with selective loss of scotopic function before age 20 years. With time, however, the photopic system becomes affected, leading to loss of the photopic visual field and of visual acuity. PMID: 12796249
  14. both Nrl and Crx are required for full transcriptional activity of the PDE6A gene PMID: 15001570
  15. the function of NRL-MTD is to activate transcription by recruiting or stabilizing TBP (and consequently other components of the general transcription complex) at the promoter of target genes PMID: 15328344
  16. Mutation analysis of the NRL gene, in patients with Enhanced S Cone Syndrome PMID: 15459973
  17. an unusual clinical phenotype in humans with loss-of-function mutations in NRL PMID: 15591106
  18. signaling by RA via RA receptors regulates the expression of NRL, providing a framework for delineating early steps in photoreceptor cell fate determination PMID: 16854989
  19. Gain-of-function mutations in the NRL gene cause autosomal dominant retinitis pigmentosa[RP] while loss-of-function mutations cause autosomal recessive RP. Differential phosphorylation of NRL fine-tunes its transcriptional regulatory activity. PMID: 17335001
  20. six isoforms of NRL (29-35 kDa) are generated by phosphorylation and expressed specifically in the mammalian retina. PMID: 11477108

Show More

Hide All

Involvement in disease
Retinitis pigmentosa 27 (RP27); Retinal degeneration autosomal recessive clumped pigment type (RDCP)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
BZIP family
Tissue Specificity
Expressed in the brain and the retina. Expressed strongly in rod and cone cells (at protein level).
Database Links

HGNC: 8002

OMIM: 162080

KEGG: hsa:4901

STRING: 9606.ENSP00000380193

UniGene: Hs.652297

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*