Recombinant Human Neurofascin (NFASC), partial

Code CSB-EP015743HU
Abbreviation Recombinant Human NFASC protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
NFASC
Uniprot No.
Research Area
Cell Adhesion
Alternative Names
KIAA0756; Neurofascin; Neurofascin homolog; NF; Nfasc; NFASC_HUMAN; NRCAML
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1239-1347aa
Target Protein Sequence
KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.9kDa
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions.
Gene References into Functions
  1. data suggest that NFASC is a novel regulator of non-small cell lung cancer cell motility and support a role of NFASC in the regulation of non-small cell lung cancer progression PMID: 28418179
  2. identified neurofascin as the target of the autoantibodies in Chronic inflammatory demyelination polyneuropathy patients. PMID: 28575198
  3. #REF! PMID: 26843559
  4. It is a common protein to the central and peripheral nervous system may play a pivotal role in combined demyelination in Combined central and peripheral demyelination. PMID: 25672685
  5. Autoantibodies to NF155 identify a inflammatory demyelinating polyradiculoneuropathy subtype characterized by severe neuropathy, poor response to intravenous immunoglobulin, and disabling tremor. PMID: 24523485
  6. Anti-neurofascin antibody is frequently present in patients with CCPD. PMID: 23884033
  7. Three neuronal proteins (Huntingtin interacting protein 1, neurofascin, and olfactomedin-like 2a) are novel components of podocyte major processes and their expression in glomerular crescents supports their role in crescent formation. PMID: 22913984
  8. gliomedin, NF186, and contactin are novel target antigens in Guillain-Barre syndrome PMID: 22462667
  9. Neurofascin isoforms of 186, 180, 166 and 155 kDa are generated by alternative splicing and provide a switch between neuronal plasticity and stability. (Review) PMID: 22306302
  10. Cerebellar pinceau organization requires coordinated mechanisms involving specific neurofascin functions in both Purkinje and basket neurons. PMID: 22492029
  11. Fibronectin type III-like domains of neurofascin-186 protein mediate gliomedin binding and its clustering at the developing nodes of Ranvier PMID: 22009740
  12. two crystal structures of a dimeric form of the headpiece of neurofascin PMID: 21047790
  13. Nfasc isoforms use distinct protein-protein interaction modules to organize and stabilize specific axonal domains in myelinated axons. Loss of Nfasc immunoglobulin domains 5 and 6 in transgenic mice mimics complete ablation of Nfasc. PMID: 20371806
  14. in both mouse and human samples, the expression pattern of neurofascin 155(high) and neurofascin 155(low) is altered coincident with paranodal decay. PMID: 20129933
  15. different splicing variants of NF expressed on neurons and glia play distinct roles during neural development PMID: 16061393
  16. raft-association of NF155 is essential for the assembly of the paranodal junction and reduced association to lipid rafts is accompanied by the disassembly of the paranodal junction and contributes to the demyelination process in multiple sclerosis PMID: 17405145
  17. antibodies to neurofascin selectively targeted nodes of Ranvier, resulting in deposition of complement, axonal injury, and disease exacerbation PMID: 17846150
  18. a neurofascin intracellular domain activates FGFR1 for neurite outgrowth, whereas the extracellular domain functions as an additional, regulatory FGFR1 interaction domain in the course of development PMID: 19666467

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 8]: Cell junction, paranodal septate junction.
Protein Families
Immunoglobulin superfamily, L1/neurofascin/NgCAM family
Database Links

HGNC: 29866

OMIM: 609145

KEGG: hsa:23114

STRING: 9606.ENSP00000344786

UniGene: Hs.13349

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*