Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), partial, Biotinylated

In Stock
Code CSB-EP887022HU-B
Abbreviation Recombinant Human CHRNA9 protein, partial, Biotinylated
MSDS
Size $308
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CHRNA9
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-237aa
Target Protein Sequence
ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
72.2 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), biotinylated, is produced in E. coli and spans amino acids 26-237. The protein includes an N-terminal MBP tag and a C-terminal 6xHis-Avi tag, which appears to offer enhanced purification and detection flexibility. This partial-length protein shows a purity greater than 85% as assessed by SDS-PAGE, which should provide reliable performance in most experimental applications.

The neuronal acetylcholine receptor subunit alpha-9 forms part of nicotinic acetylcholine receptors—integral membrane proteins that participate in synaptic transmission. These receptors seem to play a key role in modulating neurotransmitter release. Understanding them may be crucial for exploring cholinergic signaling pathways. Research on CHRNA9 could be significant for investigating synaptic function and its potential implications in neurological studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human CHRNA9 is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic transmembrane proteins like CHRNA9. CHRNA9 is a subunit of a ligand-gated ion channel that requires precise folding, post-translational modifications (e.g., glycosylation), and often assembly with other subunits for bioactivity. E. coli cannot perform eukaryotic-type modifications, and the expression of a partial fragment (26-237aa) lacking transmembrane and intracellular domains further reduces the likelihood of correct folding and function. The presence of multiple tags (N-terminal MBP, C-terminal 6xHis-Avi) and biotinylation may exacerbate folding issues. Since activity is unverified, the protein is highly likely to be misfolded and inactive. Experimental validation is critical, but the expression system and protein characteristics suggest a low probability of bioactivity.

1. Antibody Development and Validation Studies

This biotinylated CHRNA9 protein fragment may serve as an antigen for generating antibodies, as antibodies can recognize linear epitopes even if the protein is misfolded. The tags and biotinylation aid purification and detection in assays like Western blotting. However, if misfolded (as expected), the resulting antibodies may not bind the native, fully folded CHRNA9 in physiological contexts (e.g., in neuronal tissues), limiting their utility for functional studies. Validation against native CHRNA9 is essential.

2. Protein-Protein Interaction Screening

The dual tagging system and biotinylation enable technical feasibility for pull-down assays, but if CHRNA9 is misfolded, it may not interact authentically with biological partners (e.g., other receptor subunits or ligands), leading to non-physiological interactions. The tags themselves could cause artifactual binding. This application should be considered high-risk without prior folding validation. If used, results must be confirmed with alternative methods using a full-length, correctly folded protein.

3. ELISA-Based Binding Assays

The biotinylated protein can be immobilized on streptavidin-coated plates for ELISA, but if misfolded, conformational epitopes may be altered, resulting in inaccurate binding data for antibodies, ligands, or other molecules. The high purity is adequate, but assays may measure non-specific binding rather than native interactions. This application should be approached cautiously, with validation using native CHRNA9 controls.

4. Surface Plasmon Resonance (SPR) Binding Studies

SPR requires a correctly folded protein for meaningful kinetic data. If CHRNA9 is misfolded, immobilization on streptavidin chips may yield stable surfaces, but binding affinities and kinetics measured for ligands (e.g., acetylcholine or drugs) would be invalid and misleading for drug discovery. Without activity verification, SPR studies are not recommended. If pursued, initial activity assays are essential.

Final Recommendation & Action Plan

Given the high probability of misfolding due to E. coli expression and the partial length of this eukaryotic transmembrane protein, it is crucial to avoid functional applications until folding and bioactivity are validated. Prioritize using this reagent for non-functional purposes, such as antibody development for linear epitopes (with the understanding that antibodies may need further validation), and avoid interaction or binding studies until the protein's native conformation is confirmed via circular dichroism, size-exclusion chromatography, or comparison with mammalian-expressed CHRNA9. If functional studies are essential, consider alternative expression systems (e.g., insect or mammalian cells) that support proper folding and modifications. Always include controls with native protein when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding induces a conformation change that leads to the opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma. May also regulate keratinocyte adhesion.
Gene References into Functions
  1. phosphocholine inhibits ion-channel function of ATP receptor P2X7 in monocytic cells via nAChR containing alpha9 and alpha10 subunits. PMID: 27349288
  2. Behavioural and physiological stress-induced changes observed in alpha9-nAChR KO mice demonstrate a novel role of the alpha9alpha10-nAChR in mounting a normal stress response. The lack of functioning alpha9alpha10-nAChRs leads to negative affective changes after a relatively short period of stress. KO mice exhibited unusual patterns of circadian activity and a dysfunction in reward seeking after a period of reduced acc... PMID: 28408300
  3. Chemotherapy induced cold allodynia is reduced in alpha 9 knockout mice. PMID: 28223528
  4. The rare variants in CHRNA9 were significantly associated with smoking status. PMID: 25450229
  5. Our findings support a significant interaction effect existing between the CHRNA9 gene and smoking exposure on the risk of breast cancer development. PMID: 25142973
  6. CHRNA9 polymorphisms are associated with non-small cell lung cancer. PMID: 24676996
  7. Thia case-control analysis revealed that an increased risk of lung cancer is associated with two SNPs in CHRNA9, rs56159866 and rs6819385. PMID: 22280835
  8. Data suggest that the biologic activities of Alpha9 nicotinic receptor (CHRNA9) may be regulated at the splicing level, and genetic polymorphisms in CHRNA9 affecting protein levels, amino acid sequence and RNA splicing may influence the risk for lung cancer. PMID: 22125646
  9. A two order of magnitude species difference in potency of alpha-conotoxin RgIA is reported for rat versus human alpha9alpha10 nAChR. PMID: 22774872
  10. Estrogen receptor-alpha plays a central role in mediating alpha9-nAChR gene up-regulation in response to either nicotine or estradiol stimulation. PMID: 20953833
  11. Significant increases in the alpha9-nAChR mRNA and protein levels in MCF-7 cells were detected 6 h after nicotine treatment. Nicotine- and estrogen-induced alpha9-nicotinic acetylcholine receptor upregulation was blocked by (-)-epigallocatechin-3-gallate. PMID: 21370452
  12. These results suggest that alpha9-nAChR-mediated cyclin D3 overexpression is important for nicotine-induced transformation of normal human breast epithelial cells. PMID: 20229177
  13. The alpha9-nAChR is important for nicotine-induced transformation of normal human breast epithelial cells. Results imply that receptor-mediated carcinogenic signals play a decisive role in biological functions related to human breast cancer development. PMID: 20733118
  14. Chromosome location and characterization of the CHRNA9 gene. PMID: 12697997
  15. two cis-elements of the alpha9 nicotinic receptor subunit promoter control in opposite ways the basal transcriptional activity of the gene PMID: 12860975
  16. Signaling through alpha9 AChR is critical for completion of the very early stages of epithelialization. PMID: 17706194

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-9/CHRNA9 sub-subfamily
Tissue Specificity
Expressed in cochlea, keratinocytes, pituitary gland, B-cells and T-cells.
Database Links

HGNC: 14079

OMIM: 605116

KEGG: hsa:55584

STRING: 9606.ENSP00000312663

UniGene: Hs.272278

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*