Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), partial

In Stock
Code CSB-YP887022HUi4
Abbreviation Recombinant Human CHRNA9 protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of CHRNA9 was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Activity
Not Test
Target Names
CHRNA9
Uniprot No.
Research Area
Neuroscience
Alternative Names
Nicotinic acetylcholine receptor subunit alpha-9
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
26-237aa
Target Protein Sequence
ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding induces a conformation change that leads to the opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma. May also regulate keratinocyte adhesion.
Gene References into Functions
  1. phosphocholine inhibits ion-channel function of ATP receptor P2X7 in monocytic cells via nAChR containing alpha9 and alpha10 subunits. PMID: 27349288
  2. Behavioural and physiological stress-induced changes observed in alpha9-nAChR KO mice demonstrate a novel role of the alpha9alpha10-nAChR in mounting a normal stress response. The lack of functioning alpha9alpha10-nAChRs leads to negative affective changes after a relatively short period of stress. KO mice exhibited unusual patterns of circadian activity and a dysfunction in reward seeking after a period of reduced acc... PMID: 28408300
  3. Chemotherapy induced cold allodynia is reduced in alpha 9 knockout mice. PMID: 28223528
  4. The rare variants in CHRNA9 were significantly associated with smoking status. PMID: 25450229
  5. Our findings support a significant interaction effect existing between the CHRNA9 gene and smoking exposure on the risk of breast cancer development. PMID: 25142973
  6. CHRNA9 polymorphisms are associated with non-small cell lung cancer. PMID: 24676996
  7. Thia case-control analysis revealed that an increased risk of lung cancer is associated with two SNPs in CHRNA9, rs56159866 and rs6819385. PMID: 22280835
  8. Data suggest that the biologic activities of Alpha9 nicotinic receptor (CHRNA9) may be regulated at the splicing level, and genetic polymorphisms in CHRNA9 affecting protein levels, amino acid sequence and RNA splicing may influence the risk for lung cancer. PMID: 22125646
  9. A two order of magnitude species difference in potency of alpha-conotoxin RgIA is reported for rat versus human alpha9alpha10 nAChR. PMID: 22774872
  10. Estrogen receptor-alpha plays a central role in mediating alpha9-nAChR gene up-regulation in response to either nicotine or estradiol stimulation. PMID: 20953833
  11. Significant increases in the alpha9-nAChR mRNA and protein levels in MCF-7 cells were detected 6 h after nicotine treatment. Nicotine- and estrogen-induced alpha9-nicotinic acetylcholine receptor upregulation was blocked by (-)-epigallocatechin-3-gallate. PMID: 21370452
  12. These results suggest that alpha9-nAChR-mediated cyclin D3 overexpression is important for nicotine-induced transformation of normal human breast epithelial cells. PMID: 20229177
  13. The alpha9-nAChR is important for nicotine-induced transformation of normal human breast epithelial cells. Results imply that receptor-mediated carcinogenic signals play a decisive role in biological functions related to human breast cancer development. PMID: 20733118
  14. Chromosome location and characterization of the CHRNA9 gene. PMID: 12697997
  15. two cis-elements of the alpha9 nicotinic receptor subunit promoter control in opposite ways the basal transcriptional activity of the gene PMID: 12860975
  16. Signaling through alpha9 AChR is critical for completion of the very early stages of epithelialization. PMID: 17706194

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-9/CHRNA9 sub-subfamily
Tissue Specificity
Expressed in cochlea, keratinocytes, pituitary gland, B-cells and T-cells.
Database Links

HGNC: 14079

OMIM: 605116

KEGG: hsa:55584

STRING: 9606.ENSP00000312663

UniGene: Hs.272278

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*