Name: Recombinant Human Neuronal acetylcholine receptor subunit beta-2(CHRNB2),partial
Brand: CUSABIO
SKU: CSB-EP005396HU1

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	CHRNB2
Uniprot No.	P17787
Research Area	Cancer
Alternative Names	CHRNB2; Neuronal acetylcholine receptor subunit beta-2
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	26-233aa
Target Protein Sequence	TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	31.9 kDa
Protein Length	Partial
Tag Info	N-terminal 10xHis-V5-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions.
Gene References into Functions	MAFA controls autonomic nervous system-mediated insulin secretion by activating the transcription of nicotinic (ChrnB2 and ChrnB4) receptor genes, which is impaired in patients with type 2 diabetes. PMID: 26904947 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure. PMID: 25068303 The results of this study suggested that rs2072660 had a significant effect on the nicotine dependence There was no direct association between depressive phenotype (with neither ZSDS total scores and nor its subscales) and CHRNB2 variants. PMID: 25640319 Following smoking reduction and cessation alpha4beta2* nAChR densities were decreased across brain regions. PMID: 23429692 Evidence for significant association between common sequence variants in CHRNB2 and nausea severity was obtained after adjusting for age, gender and correlated tests in patients using varenicline for smoking cessation. PMID: 21606948 A novel mutant mouse harboring the human ADNFLE mutation in the Chrnb2 gene was generated and used to study the roles of beta2* nicotinic receptors in complex biological processes including the activity-rest cycle, natural reward and anxiety. PMID: 20603624 variation in the promoter region of CHRNB2 gene may be important in mediating levels of expression of the beta2 nicotinic receptor subunit, which may be associated with variation in subjective response to nicotine PMID: 20854418 mutations of CHRNB2 and CHRNA2 genes may be rare in Chinese autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE) PMID: 21287502 Concatameric pentamers and pentamers formed from combinations of trimers, dimers, and monomers of alpha6beta2beta3* acetylcholine receptors exhibit similar properties, indicating that the linkers between subunits do not alter their functional properties. PMID: 20923852 The high sensitivity to activation and desensitization of (alpha4beta2)alpha5 nAChRbeta2 by nicotine results in a narrow concentration range in which activation and desensitization curves overlap. PMID: 20881005 Using high-resolution NMR spectroscopy, we solved the structure of the entire transmembrane domain (TM1234) of the beta2 subunit. We found that TM1234 formed a four-helix bundle in the absence of the extracellular and intracellular domains. PMID: 20441771 Data suggests that beta(2)-nAChRs play a role in pain sensitivity but not pain tolerance during tobacco smoking withdrawal. PMID: 20371741 There was no evidence of association of any of the SNPs in CHRNAB2 (rs2072661, rs4845378) or CHRNAB3 (rs4953, rs6474413) with smoking status (p=0.30) or, among daily smokers, of association with cotinine levels (p=0.08). PMID: 19482438 association of a 3' untranslated region polymorphism (rs2072661) in the nicotinic acetylcholine receptor beta2 subunit (CHRNB2) gene with quitting success in response to nicotine versus placebo patch during a short-term test of patch effects. PMID: 19755656 CHRNB2 is a logical candidate for influencing smoking behavior and nicotine dependence PMID: 11906688 autosomal dominant nocturnal frontal lobe epilepsy probands were analyzed for the presence of V287L and V287M mutations in the CHRNB2 gene. No mutations in the analyzed region of CHRNB2 found. PMID: 11952766 Mutations of the gene encoding CHRNB2 may be linked to nocturnal frontal lobe epilepsy. PMID: 12185808 CHRNB2 subunit is expressed in the soma of the majority of pyramidal cells, with the most beta 2 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma. PMID: 12663058 Mutations in genes coding for the alpha 4 and beta 2 subunits of the neuronal nicotinic acetylcholine receptor receptor (CHRN) are known to cause autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE). PMID: 12681012 A significant association for Alzheimer's disease is observed for a non-coding polymorphism in CHRNB2 subunit. PMID: 15026168 Nicotinic acetylcholine receptor beta 2 subunit polymorphisms are not a useful marker for prediction of the susceptibility.to febrile seizures. PMID: 15033200 Here, we report a new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. PMID: 15964197 Greater beta2-nAChR availability during early abstinence may impact the ability of smokers to maintain abstinence. PMID: 16928859 This study provides the first evidence for association between the CHRNB2 gene and nicotine- and alcohol-related phenotypes, and suggests that polymorphisms in CHRNB2 may be important in mediating early responses to nicotine and alcohol. PMID: 17226798 To our knowledge, this is the third family reported presenting a mutation in CHRNB2 in nocturnal frontal lobe epilepsy. PMID: 17900292 These results in living human subjects corroborate postmortem reports of decline in high affinity nicotine binding with age and may aid in elucidating the role of beta(2)-nAChRs in cognitive aging. PMID: 18242781 Genetic testing revealed the CHRNB2 mutation I312M in transmembrane region 3 (M3) of the neuronal nicotinic acetylcholine receptor. PMID: 18534914 An SNP (rs2072661) in the 3' UTR region of the CHRNB2 has an impact on abstinence rates at the end of treatment and after a 6-month follow-up period. PMID: 18593715 Show More Hide All
Involvement in disease	Epilepsy, nocturnal frontal lobe, 3 (ENFL3)
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Database Links	HGNC: 1962 OMIM: 118507 KEGG: hsa:1141 STRING: 9606.ENSP00000357461 UniGene: Hs.2306

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP005396HU1
Size	$2466
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Neuronal acetylcholine receptor subunit beta-2(CHRNB2),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage