Recombinant Human Neuronal acetylcholine receptor subunit beta-2 (CHRNB2)

Code CSB-CF005396HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CHRNB2; Neuronal acetylcholine receptor subunit beta-2
Species
Homo sapiens (Human)
Expression Region
26-502
Target Protein Sequence
TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI VALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGAD SCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRFIADHMRSEDDDQ SVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTTFLHSDHSAPSSK
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are looking for an alpha subunit that binds to a-bungarotoxin.  Do you have a recommendation for this?

A:

We recommend the partial region 21-230aa.

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions.
Gene References into Functions
  1. MAFA controls autonomic nervous system-mediated insulin secretion by activating the transcription of nicotinic (ChrnB2 and ChrnB4) receptor genes, which is impaired in patients with type 2 diabetes. PMID: 26904947
  2. Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure. PMID: 25068303
  3. The results of this study suggested that rs2072660 had a significant effect on the nicotine dependence There was no direct association between depressive phenotype (with neither ZSDS total scores and nor its subscales) and CHRNB2 variants. PMID: 25640319
  4. Following smoking reduction and cessation alpha4beta2* nAChR densities were decreased across brain regions. PMID: 23429692
  5. Evidence for significant association between common sequence variants in CHRNB2 and nausea severity was obtained after adjusting for age, gender and correlated tests in patients using varenicline for smoking cessation. PMID: 21606948
  6. A novel mutant mouse harboring the human ADNFLE mutation in the Chrnb2 gene was generated and used to study the roles of beta2* nicotinic receptors in complex biological processes including the activity-rest cycle, natural reward and anxiety. PMID: 20603624
  7. variation in the promoter region of CHRNB2 gene may be important in mediating levels of expression of the beta2 nicotinic receptor subunit, which may be associated with variation in subjective response to nicotine PMID: 20854418
  8. mutations of CHRNB2 and CHRNA2 genes may be rare in Chinese autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE) PMID: 21287502
  9. Concatameric pentamers and pentamers formed from combinations of trimers, dimers, and monomers of alpha6beta2beta3* acetylcholine receptors exhibit similar properties, indicating that the linkers between subunits do not alter their functional properties. PMID: 20923852
  10. The high sensitivity to activation and desensitization of (alpha4beta2)alpha5 nAChRbeta2 by nicotine results in a narrow concentration range in which activation and desensitization curves overlap. PMID: 20881005
  11. Using high-resolution NMR spectroscopy, we solved the structure of the entire transmembrane domain (TM1234) of the beta2 subunit. We found that TM1234 formed a four-helix bundle in the absence of the extracellular and intracellular domains. PMID: 20441771
  12. Data suggests that beta(2)*-nAChRs play a role in pain sensitivity but not pain tolerance during tobacco smoking withdrawal. PMID: 20371741
  13. There was no evidence of association of any of the SNPs in CHRNAB2 (rs2072661, rs4845378) or CHRNAB3 (rs4953, rs6474413) with smoking status (p=0.30) or, among daily smokers, of association with cotinine levels (p=0.08). PMID: 19482438
  14. association of a 3' untranslated region polymorphism (rs2072661) in the nicotinic acetylcholine receptor beta2 subunit (CHRNB2) gene with quitting success in response to nicotine versus placebo patch during a short-term test of patch effects. PMID: 19755656
  15. CHRNB2 is a logical candidate for influencing smoking behavior and nicotine dependence PMID: 11906688
  16. autosomal dominant nocturnal frontal lobe epilepsy probands were analyzed for the presence of V287L and V287M mutations in the CHRNB2 gene. No mutations in the analyzed region of CHRNB2 found. PMID: 11952766
  17. Mutations of the gene encoding CHRNB2 may be linked to nocturnal frontal lobe epilepsy. PMID: 12185808
  18. CHRNB2 subunit is expressed in the soma of the majority of pyramidal cells, with the most beta 2 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma. PMID: 12663058
  19. Mutations in genes coding for the alpha 4 and beta 2 subunits of the neuronal nicotinic acetylcholine receptor receptor (CHRN) are known to cause autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE). PMID: 12681012
  20. A significant association for Alzheimer's disease is observed for a non-coding polymorphism in CHRNB2 subunit. PMID: 15026168
  21. Nicotinic acetylcholine receptor beta 2 subunit polymorphisms are not a useful marker for prediction of the susceptibility.to febrile seizures. PMID: 15033200
  22. Here, we report a new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. PMID: 15964197
  23. Greater beta2*-nAChR availability during early abstinence may impact the ability of smokers to maintain abstinence. PMID: 16928859
  24. This study provides the first evidence for association between the CHRNB2 gene and nicotine- and alcohol-related phenotypes, and suggests that polymorphisms in CHRNB2 may be important in mediating early responses to nicotine and alcohol. PMID: 17226798
  25. To our knowledge, this is the third family reported presenting a mutation in CHRNB2 in nocturnal frontal lobe epilepsy. PMID: 17900292
  26. These results in living human subjects corroborate postmortem reports of decline in high affinity nicotine binding with age and may aid in elucidating the role of beta(2)-nAChRs in cognitive aging. PMID: 18242781
  27. Genetic testing revealed the CHRNB2 mutation I312M in transmembrane region 3 (M3) of the neuronal nicotinic acetylcholine receptor. PMID: 18534914
  28. An SNP (rs2072661) in the 3' UTR region of the CHRNB2 has an impact on abstinence rates at the end of treatment and after a 6-month follow-up period. PMID: 18593715

Show More

Hide All

Involvement in disease
Epilepsy, nocturnal frontal lobe, 3 (ENFL3)
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Database Links

HGNC: 1962

OMIM: 118507

KEGG: hsa:1141

STRING: 9606.ENSP00000357461

UniGene: Hs.2306

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1