Recombinant Human Neuronal acetylcholine receptor subunit beta-4 (CHRNB4), partial

Code CSB-YP005398HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005398HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005398HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP005398HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP005398HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CHRNB4
Uniprot No.
Alternative Names
CHRNB4; Neuronal acetylcholine receptor subunit beta-4
Species
Homo sapiens (Human)
Expression Region
22-236
Target Protein Sequence
RVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWL KQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSV LWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEW DIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYT
Protein Length
partial, the first extracellular domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Gene References into Functions
  1. Identified a novel exon variant Ser140Gly of CHRNB4 , and validated two previously reported variants Tyr215Tyr and Asp398Asn are significantly associated with COPD risk in Chinese. PMID: 25891420
  2. We identified 10 low frequency non-synonymous variants in CHRNB4, and found a highly significant correlation between carrier status weighted by either ACh EC50 or by low response to nicotine. PMID: 24804708
  3. Unmethylation of the CHRNB4 gene is an unfavorable prognostic factor in non-small cell lung cancer. PMID: 25172267
  4. Elucidation of molecular impediments in the alpha6 subunit for in vitro expression of functional alpha6beta4* nicotinic acetylcholine receptors. PMID: 24085295
  5. the importance of SNP rs1948 on the regulation of CHRNB4 expression PMID: 23691088
  6. epigenetic deregulation of nicotinic acetylcholine receptor subunit (nAChR) genes which in the case of CHRNB4 is strongly associated with genetic lung cancer susceptibility variants and a functional impact on tumorigenic potential PMID: 22945651
  7. Genetic variation in the CHRNA5-CHRNA3-CHRNB4 gene cluster, encoding the alpha5, alpha3, and beta4 nAChR subunits, respectively, has been shown to increase vulnerability to tobacco dependence PMID: 23143843
  8. The SNP rs 12914008 on CHRNB4 that is not statically associated with COPD risk is a positive factor in Bupropion treatment while its effect on NRT is controversial. PMID: 23061658
  9. Overexpression of alpha3/alpha5/beta4 nicotinic acetylcholine receptor subunits produces changes in two specific aspects of executive functioning--working memory and response inhibition--that may be related to nicotine dependence vulnerability. PMID: 22024278
  10. functional properties of nAChRs containing beta4R349C subunit; mutation caused reduction in potency of ACh and nicotine, decreased density of whole-cell current evoked by maximal transmitter concentrations, altered kinetics of ACh-evoked whole-cell currents PMID: 21107856
  11. Single nucleotide polymorphisma in CHRNB4 showed suggestive association with the comorbidity of depression and nicotine dependence. PMID: 22241830
  12. Compared with etomidate, carboetomidate's higher hydrophobicity is associated with greater inhibition of alpha4/beta2 neuronal nicotinic acetylcholine receptors. PMID: 22543065
  13. Missense variants at conserved residues in CHRNB4 are associated with lower risk for nicotine dependence in African Americans and European Americans. PMID: 22042774
  14. Quantitative trait disequilibrium test (QTDT) significant association was detected between age at onset of daily smoking and variants located upstream of CHRNB4. PMID: 22438940
  15. Single nucleotide polymorphism (SNP) CHRNB4 on chromosome 15 is not associated with Parkinson's disease risk in the overall anaylsis or after stratifying on smoking status. PMID: 21228559
  16. alpha6beta4* nAChRs are expressed and contribute to exocytosis in human chromaffin cells of the adrenal gland, the main source of adrenaline under stressful situations. PMID: 21917987
  17. Single Nucleotide Polymorphisms in CHRNB4 is associated with smoking persistence in African Americans. PMID: 21436384
  18. Variation in the nicotinic acetylcholine receptor gene cluster CHRNA5-CHRNA3-CHRNB4 influences cognitive flexibility differently in African Americans and European Americans. PMID: 20631687
  19. CHRNB4 subunit is expressed in the soma of the majority of pyramidal cells, with fairly consistent immunoreactivity observed throughout the different regions of the hippocampus. PMID: 12663058
  20. The receptors containing the R136W and M467V mutations (or variants) had a higher sensitivity to acetylcholine and lower EC50 than the wild-type. PMID: 15742216
  21. CHRNB4 seem to exert no relevant influence on smoking cessation probability in heavy smokers in the general population. PMID: 18996504

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-4/CHRNB4 sub-subfamily
Database Links

HGNC: 1964

OMIM: 118509

KEGG: hsa:1143

STRING: 9606.ENSP00000261751

UniGene: Hs.624178

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1