Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
metastatic inhibition factor NM23H4; mitochondrial; NDK; NDKM_HUMAN; NDP kinase; NDP kinase D; NDP kinase, mitochondrial; NDPK D; NDPKD; nm23 H4; nm23-H4; NM23D; NM23H4; Nm23M4; NME/NM23 nucleoside diphosphate kinase 4; NME4; Non metastatic cells 4 protein expressed in; Non metastatic protein 23, homolog 4; Nucleoside diphosphate kinase D; Nucleoside diphosphate kinase, mitochondrial; Nucleoside diphosphate kinase, mitochondrial
Species
Homo sapiens (Human)
Expression Region
1-187aa
Target Protein Sequence
SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human NME4 recombinant protein was produced in E.coli, where the gene sequence encoding Human NME4 (1-187aa) was expressed with the N-terminal GST tag. The purity of this NME4 protein was greater than 90% by SDS-PAGE.
NME4 is an enzyme located within the mitochondria, and it is associated with nucleotide metabolism and cellular energy production. Specifically, NME4 catalyzes the reaction of nucleotide diphosphorylation, converting a nucleotide monophosphate into a nucleotide diphosphate. This is an important biochemical process that occurs within mitochondria and is closely related to the generation of adenosine triphosphate (ATP). The primary biological role of NME4 is to maintain the production of ATP within the mitochondria. ATP is the primary energy molecule inside cells, and it plays a crucial role in various biological processes, including muscle contraction, cell signal transduction, and cell division. Therefore, NME4 is essential for maintaining normal cellular functions and survival by ensuring an adequate supply of ATP.