Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NME4

Uniprot No.

O00746

Research Area

Signal Transduction

Alternative Names

metastatic inhibition factor NM23H4; mitochondrial; NDK; NDKM_HUMAN; NDP kinase; NDP kinase D; NDP kinase, mitochondrial; NDPK D; NDPKD; nm23 H4; nm23-H4; NM23D; NM23H4; Nm23M4; NME/NM23 nucleoside diphosphate kinase 4; NME4; Non metastatic cells 4 protein expressed in; Non metastatic protein 23, homolog 4; Nucleoside diphosphate kinase D; Nucleoside diphosphate kinase, mitochondrial; Nucleoside diphosphate kinase, mitochondrial

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-187aa

Target Protein Sequence

SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.3kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Human NME4 recombinant protein was produced in E.coli, where the gene sequence encoding Human NME4 (1-187aa) was expressed with the N-terminal GST tag. The purity of this NME4 protein was greater than 90% by SDS-PAGE.
NME4 is an enzyme located within the mitochondria, and it is associated with nucleotide metabolism and cellular energy production. Specifically, NME4 catalyzes the reaction of nucleotide diphosphorylation, converting a nucleotide monophosphate into a nucleotide diphosphate. This is an important biochemical process that occurs within mitochondria and is closely related to the generation of adenosine triphosphate (ATP). The primary biological role of NME4 is to maintain the production of ATP within the mitochondria. ATP is the primary energy molecule inside cells, and it plays a crucial role in various biological processes, including muscle contraction, cell signal transduction, and cell division. Therefore, NME4 is essential for maintaining normal cellular functions and survival by ensuring an adequate supply of ATP.

Target Background

Function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling.

Gene References into Functions

NDPK-D has an important role in the early stages of mitophagy as induced by carbonyl cyanide m-chlorophenylhydrazone as well as by PINK1-Parkin-independent stimuli such as rotenone and 6-hydroxydopamine. PMID: 26742431
Mitochondrial NM23-H4/NDPK-D: a bifunctional nanoswitch for bioenergetics and lipid signaling PMID: 25231795
miR-196 performed it's their function by inhibiting NME4 expression and further activating p-JNK, suppressing TIMP1, and augmenting MMP1/9. PMID: 25233933
Nm23-H4 acts as a lipid-dependent mitochondrial switch with dual function in phosphotransfer serving local GTP supply and cardiolipin transfer for apoptotic signaling and putative other functions PMID: 23150663
High expression of ERCC1, FLT1, NME4 and PCNA in myelodysplastic syndrome was associated with poor prognosis and disease progression along the sequence of 5q-syndrome/RCMD/RAEB/de novo AML PMID: 18604718

Hide All

Subcellular Location

Mitochondrion intermembrane space; Peripheral membrane protein. Mitochondrion matrix.

Protein Families

NDK family

Tissue Specificity

Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.

Database Links

HGNC: 7852

OMIM: 601818

KEGG: hsa:4833

STRING: 9606.ENSP00000219479

UniGene: Hs.9235

Code	CSB-EP015889HU
Abbreviation	Recombinant Human NME4 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage