Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4)

In Stock
Code CSB-EP015889HU
Abbreviation Recombinant Human NME4 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
NME4
Uniprot No.
Research Area
Signal Transduction
Alternative Names
metastatic inhibition factor NM23H4; mitochondrial; NDK; NDKM_HUMAN; NDP kinase; NDP kinase D; NDP kinase, mitochondrial; NDPK D; NDPKD; nm23 H4; nm23-H4; NM23D; NM23H4; Nm23M4; NME/NM23 nucleoside diphosphate kinase 4; NME4; Non metastatic cells 4 protein expressed in; Non metastatic protein 23, homolog 4; Nucleoside diphosphate kinase D; Nucleoside diphosphate kinase, mitochondrial; Nucleoside diphosphate kinase, mitochondrial
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-187aa
Target Protein Sequence
SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.3kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Human NME4 recombinant protein was produced in E.coli, where the gene sequence encoding Human NME4 (1-187aa) was expressed with the N-terminal GST tag. The purity of this NME4 protein was greater than 90% by SDS-PAGE.
NME4 is an enzyme located within the mitochondria, and it is associated with nucleotide metabolism and cellular energy production. Specifically, NME4 catalyzes the reaction of nucleotide diphosphorylation, converting a nucleotide monophosphate into a nucleotide diphosphate. This is an important biochemical process that occurs within mitochondria and is closely related to the generation of adenosine triphosphate (ATP). The primary biological role of NME4 is to maintain the production of ATP within the mitochondria. ATP is the primary energy molecule inside cells, and it plays a crucial role in various biological processes, including muscle contraction, cell signal transduction, and cell division. Therefore, NME4 is essential for maintaining normal cellular functions and survival by ensuring an adequate supply of ATP.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling.
Gene References into Functions
  1. NDPK-D has an important role in the early stages of mitophagy as induced by carbonyl cyanide m-chlorophenylhydrazone as well as by PINK1-Parkin-independent stimuli such as rotenone and 6-hydroxydopamine. PMID: 26742431
  2. Mitochondrial NM23-H4/NDPK-D: a bifunctional nanoswitch for bioenergetics and lipid signaling PMID: 25231795
  3. miR-196 performed it's their function by inhibiting NME4 expression and further activating p-JNK, suppressing TIMP1, and augmenting MMP1/9. PMID: 25233933
  4. Nm23-H4 acts as a lipid-dependent mitochondrial switch with dual function in phosphotransfer serving local GTP supply and cardiolipin transfer for apoptotic signaling and putative other functions PMID: 23150663
  5. High expression of ERCC1, FLT1, NME4 and PCNA in myelodysplastic syndrome was associated with poor prognosis and disease progression along the sequence of 5q-syndrome/RCMD/RAEB/de novo AML PMID: 18604718

Show More

Hide All

Subcellular Location
Mitochondrion intermembrane space; Peripheral membrane protein. Mitochondrion matrix.
Protein Families
NDK family
Tissue Specificity
Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
Database Links

HGNC: 7852

OMIM: 601818

KEGG: hsa:4833

STRING: 9606.ENSP00000219479

UniGene: Hs.9235

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*