Recombinant Human Nucleosome assembly protein 1-like 4 (NAP1L4)

In Stock
Code CSB-EP015444HU
Abbreviation Recombinant Human NAP1L4 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
NAP1L4
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
(Nucleosome assembly protein 2)(NAP-2)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-375aa
Target Protein Sequence
ADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In the process of expressing the recombinant Human NAP1L4 protein, e.coli cells are transfected with a DNA expression vector that carries the gene encoding the desired protein (2-375aa). The cells are then cultured to induce the expression of the intended protein. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. The recombinant Human NAP1L4 protein is collected and purified from the cell lysate through affinity purification, with its purity surpassing 90%, as assessed by SDS-PAGE.

Related Products

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Recombinant proteins and the detection of TAAbs by ELISA

Review: All 15 proteins used in ELISA were purchased from CUSABIO (SF3B3, RUNX1T1, SARS, PAIP1, CAST, MAGEA12, CCDC6, RAD23A, NOL7, CRLF3, NAP1L4, SH2B1, LARP6, Wuhan, China). The scatter dot plot of the optical density (OD) values of ELISA for 8 TAAbs in the specific validation set.

By Anonymous

Target Background

Function
Acts as histone chaperone in nucleosome assembly.
Gene References into Functions
  1. Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells. PMID: 20644730
  2. NAP-2 is in complex(es) with other proteins, which are distinct from histones PMID: 15368365
  3. Human Nap2 promotes nucleosome assembly with H3t/H4. PMID: 18281699
Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Nucleosome assembly protein (NAP) family
Tissue Specificity
Ubiquitous. Biallelically expressed in fetal and adult tissues. Highest levels in testis.
Database Links

HGNC: 7640

OMIM: 601651

KEGG: hsa:4676

STRING: 9606.ENSP00000369915

UniGene: Hs.731784

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*