Recombinant Human POU domain class 2-associating factor 1 (POU2AF1)

In Stock
Code CSB-EP620973HU
Abbreviation Recombinant Human POU2AF1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
POU2AF1
Uniprot No.
Research Area
Transcription
Alternative Names
B cell Oct binding protein 1; B cell specific coactivator OBF 1; B cell specific coactivator OBF1; B-cell-specific coactivator OBF-1; BOB 1; BOB-1; OBF 1; OBF1; OBF1_HUMAN; OCA B; OCA-B; OCAB; OCT binding factor 1; OCT-binding factor 1; POU class 2 associating factor 1; POU domain class 2 associating factor 1; POU domain class 2-associating factor 1; Pou2af1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-256aa
Target Protein Sequence
MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human POU domain class 2-associating factor 1 (POU2AF1) is produced in E. coli and contains the complete protein sequence from amino acids 1-256. The protein includes an N-terminal 6xHis-tag for easier purification and detection. SDS-PAGE analysis shows purity levels above 90%, making it appropriate for research work. This product is strictly for research use only and should not be used for diagnostic or therapeutic purposes.

POU2AF1 appears to play an important role in controlling gene expression within B cells. The protein is known to interact with octamer-binding transcription factors, boosting their activity. It seems to be a key player in transcriptional regulation pathways, which may help researchers better understand immune system processes and how cells differentiate.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human POU2AF1 is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic transcriptional co-activators. POU2AF1 requires precise folding, specific protein-protein interactions with POU domain transcription factors, and likely post-translational modifications for its co-activator function. While the protein is full-length (1-256aa) with an N-terminal 6xHis tag and >90% purity, E. coli lacks the eukaryotic chaperones and modification machinery necessary for proper folding of complex transcriptional regulators. The N-terminal His-tag may interfere with the native protein structure, particularly if the N-terminus is important for functional interactions. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its co-activator function and POU domain binding capability.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis tag enables technical feasibility for pull-down assays, but if POU2AF1 is misfolded (as likely in E. coli), it will not interact physiologically with true binding partners (e.g., POU domain transcription factors). The protein requires precise conformation for specific co-activator interactions. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding and POU domain binding activity.

2. Antibody Development and Validation

The recombinant POU2AF1 can serve as an effective immunogen for generating antibodies that recognize linear epitopes, even if the protein is misfolded. The full-length sequence ensures broad epitope coverage. However, antibodies may not recognize conformational or modification-dependent epitopes of native, properly folded POU2AF1 in human cells. Validation against endogenous POU2AF1 from mammalian systems is essential.

3. Biochemical Characterization and Stability Studies

This application is well-suited for assessing the recombinant human POU2AF1 itself. Techniques like circular dichroism spectroscopy, size-exclusion chromatography, and thermal shift assays can evaluate the protein's folding state, oligomerization, and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant human POU2AF1 and can inform about its suitability for other applications.

4. In Vitro Transcription Assays as a Co-activator

This application is highly problematic without activity verification. If POU2AF1 is misfolded, it will not function properly as a transcriptional co-activator in cell-free systems. Transcription assays require precise protein-protein interactions with transcription factors and the basal transcriptional machinery. This application requires prior demonstration of proper folding and co-activator activity with known POU domain partners.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this complex eukaryotic transcriptional co-activator, we recommend first performing comprehensive validation: 1) Biophysical characterization (circular dichroism for secondary structure, analytical ultracentrifugation for oligomeric state) to assess folding quality; 2) Functional validation of POU domain binding using known interaction partners (e.g., OCT proteins) and co-activator activity in reporter assays; 3) If possible, comparison with POU2AF1 from mammalian expression systems. Antibody development can proceed immediately as the safest application. Avoid all functional studies (interactions, transcription assays) until proper folding and co-activator activity are confirmed. For reliable POU2AF1 functional studies, obtain the protein from mammalian expression systems capable of proper folding and post-translational modifications. Always include appropriate controls, such as known POU domain proteins and validated transcriptional reporters, in experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional coactivator that specifically associates with either POU2F1/OCT1 or POU2F2/OCT2. It boosts the POU2F1/OCT1 mediated promoter activity and to a lesser extent, that of POU2F2/OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of POU2F1/OCT1 and POU2F2/OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers. Regulates IL6 expression in B cells as POU2F2/OCT2 coactivator.
Gene References into Functions
  1. The number of follicular B2 lymphocytes and expression of the B-cell-specific transcriptional coactivator OcaB increase with age in spleen and in intra-abdominal epididymal white adipose tissue (eWAT), concomitantly with higher circulating levels of IgG and impaired glucose homeostasis. PMID: 29496744
  2. These findings demonstrate for the first time that functional polymorphism in the 3'-UTR of POU2AF1 is associated with susceptibility, and that single-nucleotide polymorphisms interaction with hsa-miR-633 affects gene expression and increases the risk of lymphoma. PMID: 28345816
  3. Oct2 and Bob1 are very reliable in determining B cell lineage in the absence of expression of other pan-B cell markers PMID: 27319306
  4. these findings suggest a novel function of POU2AF1 as a potential regulator of host defense genes in the human airway epithelium. PMID: 26927796
  5. It has been identified as a new disease susceptibility gene among Japanese. Though different from Europeans, it is indicated that a B lymphocyte differentiation route shares a common disease developing process. [Review] PMID: 24005100
  6. Two significant susceptibility loci, TNFSF15 (rs4979462) and POU2AF1 (rs4938534) (combined odds ratio [OR] = 1.56, p = 2.84 x 10(-14) for rs4979462. PMID: 23000144
  7. genetic polymorphism is associated with common variable immunodeficiency PMID: 21905497
  8. Data show that Igh 3' enhancer-bound OCA-B and promoter-bound TFII-I mediate promoter-enhancer interactions, in both cis and trans, that are important for Igh transcription. PMID: 21549311
  9. On multivariate analysis, co-expression of OCT-2/BOB.1 remained predictive for achievement of complete remission and increased risk of relapse. PMID: 20141429
  10. BOB.1 may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401
  11. The expression of the octamer cofactor gene OBF-1 (Bob1/OCA-B) is sufficient to override the silencing effects of the B29 silencer, indicating that OBF-1 plays a critical role in B cell-specific B29 promoter expression. PMID: 11907094
  12. enhances transcriptional potential of Oct1 PMID: 12727885
  13. OCA-B sustains expression of the immunoglobulin-secreting program when T lymphoma and plasmacytoma lines are fused, requiring Oct-2 coregulator for its function. PMID: 14662861
  14. POU2AF1 was observed to be differentially expressed in the cells of patients with chronic lymphocytic leukemia. PMID: 15672409
  15. Alteration of the BOB1 locus does not correlate with its suppressed expression in Hodgkin lymphoma. PMID: 15796964
  16. Novel germ cell markers BOB1 were significantly upregulated in seminoma specimens, compared to normal testes. PMID: 17785371
  17. Oct-2 and its cofactor Bob-1 have an important function in mediating the IgH enhancer-bcl-2 promoter region interactions PMID: 18695675

Show More

Hide All

Involvement in disease
A chromosomal aberration involving POU2AF1/OBF1 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with BCL6.
Subcellular Location
Nucleus.
Protein Families
POU2AF1 family
Tissue Specificity
B-cell specific. Detected in mainly in spleen, but also in thymus, periphral blood leukocyte and small intestine.
Database Links

HGNC: 9211

OMIM: 601206

KEGG: hsa:5450

STRING: 9606.ENSP00000376786

UniGene: Hs.654525

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*