Recombinant Human POU domain class 2-associating factor 1 (POU2AF1)

In Stock
Code CSB-EP620973HU
Abbreviation Recombinant Human POU2AF1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
POU2AF1
Uniprot No.
Research Area
Transcription
Alternative Names
B cell Oct binding protein 1; B cell specific coactivator OBF 1; B cell specific coactivator OBF1; B-cell-specific coactivator OBF-1; BOB 1; BOB-1; OBF 1; OBF1; OBF1_HUMAN; OCA B; OCA-B; OCAB; OCT binding factor 1; OCT-binding factor 1; POU class 2 associating factor 1; POU domain class 2 associating factor 1; POU domain class 2-associating factor 1; Pou2af1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-256aa
Target Protein Sequence
MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional coactivator that specifically associates with either POU2F1/OCT1 or POU2F2/OCT2. It boosts the POU2F1/OCT1 mediated promoter activity and to a lesser extent, that of POU2F2/OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of POU2F1/OCT1 and POU2F2/OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers. Regulates IL6 expression in B cells as POU2F2/OCT2 coactivator.
Gene References into Functions
  1. The number of follicular B2 lymphocytes and expression of the B-cell-specific transcriptional coactivator OcaB increase with age in spleen and in intra-abdominal epididymal white adipose tissue (eWAT), concomitantly with higher circulating levels of IgG and impaired glucose homeostasis. PMID: 29496744
  2. These findings demonstrate for the first time that functional polymorphism in the 3'-UTR of POU2AF1 is associated with susceptibility, and that single-nucleotide polymorphisms interaction with hsa-miR-633 affects gene expression and increases the risk of lymphoma. PMID: 28345816
  3. Oct2 and Bob1 are very reliable in determining B cell lineage in the absence of expression of other pan-B cell markers PMID: 27319306
  4. these findings suggest a novel function of POU2AF1 as a potential regulator of host defense genes in the human airway epithelium. PMID: 26927796
  5. It has been identified as a new disease susceptibility gene among Japanese. Though different from Europeans, it is indicated that a B lymphocyte differentiation route shares a common disease developing process. [Review] PMID: 24005100
  6. Two significant susceptibility loci, TNFSF15 (rs4979462) and POU2AF1 (rs4938534) (combined odds ratio [OR] = 1.56, p = 2.84 x 10(-14) for rs4979462. PMID: 23000144
  7. genetic polymorphism is associated with common variable immunodeficiency PMID: 21905497
  8. Data show that Igh 3' enhancer-bound OCA-B and promoter-bound TFII-I mediate promoter-enhancer interactions, in both cis and trans, that are important for Igh transcription. PMID: 21549311
  9. On multivariate analysis, co-expression of OCT-2/BOB.1 remained predictive for achievement of complete remission and increased risk of relapse. PMID: 20141429
  10. BOB.1 may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401
  11. The expression of the octamer cofactor gene OBF-1 (Bob1/OCA-B) is sufficient to override the silencing effects of the B29 silencer, indicating that OBF-1 plays a critical role in B cell-specific B29 promoter expression. PMID: 11907094
  12. enhances transcriptional potential of Oct1 PMID: 12727885
  13. OCA-B sustains expression of the immunoglobulin-secreting program when T lymphoma and plasmacytoma lines are fused, requiring Oct-2 coregulator for its function. PMID: 14662861
  14. POU2AF1 was observed to be differentially expressed in the cells of patients with chronic lymphocytic leukemia. PMID: 15672409
  15. Alteration of the BOB1 locus does not correlate with its suppressed expression in Hodgkin lymphoma. PMID: 15796964
  16. Novel germ cell markers BOB1 were significantly upregulated in seminoma specimens, compared to normal testes. PMID: 17785371
  17. Oct-2 and its cofactor Bob-1 have an important function in mediating the IgH enhancer-bcl-2 promoter region interactions PMID: 18695675

Show More

Hide All

Involvement in disease
A chromosomal aberration involving POU2AF1/OBF1 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with BCL6.
Subcellular Location
Nucleus.
Protein Families
POU2AF1 family
Tissue Specificity
B-cell specific. Detected in mainly in spleen, but also in thymus, periphral blood leukocyte and small intestine.
Database Links

HGNC: 9211

OMIM: 601206

KEGG: hsa:5450

STRING: 9606.ENSP00000376786

UniGene: Hs.654525

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*