Recombinant Human Paired box protein Pax-8 (PAX8)

In Stock
Code CSB-EP017494HU
Abbreviation Recombinant Human PAX8 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
OTTHUMP00000158659; OTTHUMP00000158660; OTTHUMP00000203723; OTTHUMP00000203724; Paired box 8; Paired box gene 8; paired box homeotic gene 8; Paired box protein Pax 8; Paired box protein Pax-8; Paired domain gene 8; PAX 8; PAX8; PAX8_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-450aa
Target Protein Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Paired box protein Pax-8 (PAX8) is produced in an E.coli expression system, which appears to ensure high-quality synthesis. This full-length protein spans amino acids 1-450. It comes with both an N-terminal 10xHis-tag and a C-terminal Myc-tag, making detection and purification more straightforward. The protein shows a purity level exceeding 90%, as verified by SDS-PAGE, and is intended for research use only.

PAX8 serves as a transcription factor that's crucial to developmental processes, particularly those involving the thyroid gland. The protein is actively involved in regulating gene expression necessary for organogenesis. Research on PAX8 may be vital for understanding its role in cellular differentiation and developmental pathways. This work likely contributes to broader insights in molecular biology and genetics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

PAX8 is a transcription factor containing a DNA-binding paired domain and requires precise folding for its transcriptional activity. E. coli, as a prokaryotic system, lacks the eukaryotic chaperones and post-translational modification machinery necessary for proper folding of complex eukaryotic transcription factors. The dual tagging system, particularly the large tags, may sterically interfere with the DNA-binding domain and functional regions. Without experimental validation (e.g., electrophoretic mobility shift assays for DNA binding), the protein cannot be assumed to be correctly folded or bioactive. The high purity indicates low impurities, but does not guarantee functional conformation.

1. Antibody Development and Validation Studies

The recombinant PAX8 can serve as an immunogen for generating antibodies against linear epitopes, even if misfolded. The dual tags provide additional epitopes for antibody screening. However, antibodies generated may not recognize conformational epitopes of native, properly folded PAX8. Validate antibody specificity against endogenous PAX8 from human cell nuclei.

2. Protein-Protein Interaction Studies

The dual tags enable pull-down assays, but if PAX8 is misfolded, interactions may be non-physiological. The tags themselves may cause artifactual binding. Validate any identified interactions (especially with known partners like transcription cofactors) using full-length PAX8 from eukaryotic expression systems.

3. Biochemical Characterization and Stability Studies

The recombinant PAX8 is suitable for basic biophysical analysis (e.g., thermal stability, aggregation state). However, data may not reflect native PAX8 properties due to potential misfolding and the dual tags. Use techniques like circular dichroism to assess secondary structure, but interpret results cautiously without DNA-binding validation.

4. ELISA-Based Quantitative Assays

Feasible for developing ELISA assays, but if PAX8 is misfolded, the assay may not accurately quantify native PAX8. The tags may block epitopes or affect antibody binding. Validate the ELISA with native PAX8 standards from eukaryotic cells to ensure correlation with physiological levels.

Final Recommendation & Action Plan

Before using this recombinant PAX8 for functional studies, validate its folding and DNA-binding capability. Start with an electrophoretic mobility shift assay (EMSA) using a known PAX8-binding DNA sequence to confirm DNA-binding activity. If active, proceed with interaction or functional studies; if inactive, limit use to non-functional applications like antibody production (with validation against native PAX8). For reliable results, consider expressing PAX8 in a eukaryotic system (e.g., mammalian cells) that supports proper folding. Always include appropriate controls with native PAX8 when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
Gene References into Functions
  1. PAX8-PPARG fusions may not play major roles in the tumorigenesis of paediatric follicular thyroid carcinoma. PMID: 28621837
  2. Identify several novel PAX8 mutations in congenital hypothyroidism patients that impair the binding or activating abilities of PAX8 at the promoters of the target genes thyroglobulin and thyroperoxidase. PMID: 28060725
  3. Data suggest that candidate genes and pathways regulated by PAX8 that could be additional targets for the therapy of ovarian carcinoma. PMID: 27259239
  4. PAX8 has a cell specific role in governing proliferation and migration in nontransformed ovarian surface epithelium cells compared to the oviductal cells, but its reduction in serous cancer cell lines provides a common mechanism for reducing cell survival. PMID: 27129161
  5. findings proved that iodinated TG in thyroid follicular lumen regulated TTF-1 and PAX8 expression through thyroid stimulating hormone/thyroid stimulating hormone receptor (TSH/TSHR) mediated cAMP-PKA and PLC-PKC signaling pathways. PMID: 28322461
  6. Case Report: primary seminal vesicle carcinoma strong and diffuse nuclear labeling for PAX8. PMID: 28506732
  7. PAX8 is expressed in both benign and malignant mesothelium, and that BAP1 loss is highly specific for malignant peritoneal neoplasms, in the differential with both benign mesothelial proliferations and ovarian serous tumors. PMID: 28877056
  8. Although the exact biological function remains to be explored, our findings suggest a possible association of PAX8eQTLs in lncRNA AC016683.6 with the hepatocellular carcinoma prognosis in the Chinese population. PMID: 28339471
  9. findings point to significant PTC-associated dysregulation of several PAX8 target genes, supporting the notion that PAX8-regulated molecular cascades play important roles during thyroid tumorigenesis PMID: 27249794
  10. Putative PAX8 target genes are enriched for common serous epithelial ovarian cancer risk variants. PMID: 28103614
  11. We conclude that PAX8 immunostain is negative in most cervical cell carcinomas and is less frequently expressed in endocervical adenocarcinomas as compared with the previously reported high sensitivity for ovarian and endometrial adenocarcinomas PMID: 27362905
  12. Study postulated that both TTF-1 and PAX-8 when co-expressed and have anti-proliferative and anti-tumorigenic properties up to a threshold expression level and beyond that, are able to induce pro-tumorigenic effects in thyroid carcinomas. PMID: 27573549
  13. Direct sequencing of the PAX8 gene revealed a novel single nucleotide substitution (c.162 A>T) in exon 2 that resulted in the substitution of the normal serine 54 with a cysteine (S54C), which segregated with elevated serum TSH levels. PMID: 27207603
  14. This is the first report of PAX8 aberrant transcript production in cervical cancer. Reported PAX8 isoforms possess differential transactivation properties; therefore, besides being a helpful marker for detection of cancer, PAX8 isoforms can plausibly exert differential regulation properties during carcinogenesis PMID: 27175788
  15. PAX2, PAX8, CDX2 immunostains was preformed to the TMA slides. PMID: 26797858
  16. Pax8 gene Rearrangement is associated with Breast Cancer. PMID: 27797226
  17. PAX8 was negative in all cases of pulmonary neuroendocrine carcinoma (PNEC) while positive in 86.4% of thymic cases (TNEC). TTF-1 positivity was associated with high sensitivity but low specificity for PNEC, and adding PAX8 negativity significantly increased the specificity. PAX8 positivity alone showed essentially 100% specificity and 86.4% sensitivity for TNEC. PMID: 27761900
  18. Study suggested that PAX8 eQTLs SNPs (rs4848320 and rs1110839) located in lncRNA PAX8-AS1 might predict decreased risk of cervical cancer. PMID: 27225188
  19. High Levels of mRNA of both PAX8 are associated with benign than in malignant thyroid lesions. PMID: 26370671
  20. results indicate that presence of PAX8 immunoreactivity in an undifferentiated brain tumor lacking gliofibrillary acidic protein expression should prompt consideration of a metastatic tumor PMID: 26371431
  21. rete ovarii were positive for PAX-8, weakly positive for SF-1, and negative for PAX-2 and GATA-3 PMID: 26352548
  22. showing that the PAX8 mutation rate is very low in thyroid dysgenesis patients in China PMID: 26617871
  23. a substantial minority of solitary fibrous tumors express nuclear PAX8 and PAX2 PMID: 26404914
  24. PAX8 staining is useful for distinguishing between primary thyroid squamous cell carcinoma and invasion or metastasis from extrathyroidal squamous cell carcinoma. PMID: 26354716
  25. PAX8 is expressed in the majority of benign, premalignant, and malignant endocervical glandular lesions. PMID: 26910219
  26. PAX8 mutation rate among congenital hypothyroidism patients PMID: 26362610
  27. the novel interplay between PAX8 and Neuropilin-2 PMID: 26030152
  28. Heterozygous transition in exon 3 of PAX8 gene is associated with hyroid hypoplasia. PMID: 25720050
  29. miR-146b-3p binds to the 3'-untranslated region of PAX8 and sodium/iodide symporter. miR-146b and PAX8 regulate each other and share common target genes. PMID: 26282166
  30. we examined PAX8-PPARgamma rearrangement in 24 follicular thyroid carcinoma samples from Japanese patients. The fusion gene was detected in only one of 24 follicular thyroid carcinomas (4%). PMID: 25708358
  31. PAX8 protein expression was associated with germinal layers in forebrain and hindbrain development...and PAX8 expression is linked to better prognosis in medulloblastomas PMID: 25287489
  32. PAX2 and PAX8 are useful biomarker in the differential diagnosis of ovarian serous and mucinous tumors PMID: 24992169
  33. immunohistochemical marker, which allows to differentiate seminal vesicle from prostate gland epithelium in prostate needle biopsies PMID: 25153494
  34. PAX6 and PAX8 positivity was seen in of metastatic pancreatic neuroendocrine tumors to the liver PMID: 25433656
  35. In this series, PAX8/PPARgamma rearrangement found in thyroid nodules had a 100% predictive value for differentiated thyroid cancer PMID: 24798894
  36. Compared with RAS or PAX8/PPARG-positive TCs, BRAFV600E or RET/PTC-positive Thyroid cancers were more often associated with stage III/IV disease and recurrence. PMID: 26258321
  37. PAX8 (mAb) was a specific marker in differentiating primary and extragenital metastatic mucinous ovarian tumours. PMID: 25827135
  38. PAX8 is frequently expressed by ovarian surface epithelial cells, and endogenous levels of PAX8 expression are non-transforming. PMID: 26079312
  39. Case Report: novel PAX8 mutation is responsible for a severe form of dominantly inherited congenital hypothyroidism. The mutation seems to be associated with abnormalities of the urogenital tract. PMID: 23647375
  40. PAX8 immunoexpression was noticed in five and three cases of alveolar rhabdomyosarcomas and embryonal rhabdomyosarcomas, respectively. About one-third of malignant rhabdoid tumors were PAX2-positive and PAX8-positive. PMID: 24897005
  41. PAX8 is expressed in the vast majority of uterine adenocarcinomas, and that the level of expression based on combined extent and intensity is highest in endometrial serous carcinoma and lowest in endocervical adenocarcinoma. PMID: 25083965
  42. useful in distinguishing thymic carcinoma from poorly differentiated lung carcinoma PMID: 23958552
  43. We reviewed the reliability of PAX8 to determine tumor type or primary site in 135 current clinical pelvic or abdominal lesions PMID: 24857336
  44. The 5'-flanking region of the Wnt4 gene is responsive to Pax8. Pax8 modulates the expression of Wnt4 in thyroid cells. PMID: 25270402
  45. our results indicate that PAX8 plays an important role in the tumorigenic phenotype of ovarian cancer cells and identifies PAX8 as a potential new target for the treatment of ovarian cancer. PMID: 24766781
  46. PAX8 is expressed in the carcinomatous components of nearly all uterine malignant mesodermal mixed tumors, with expression in sarcomatous and undifferentiated components being less common and less extensive. PMID: 24901404
  47. This study confirms that PAX-8 expression is a useful diagnostic marker for renal cell carcinoma PMID: 25315900
  48. PAX8 is increased in the majority of glioblastomas and promoted cell survival. PMID: 24602166
  49. R133W-PAX8 variant is associated with phenotype ranging from congenital hypothyroidism with thyroid hypoplasia to mild subclinical hypothyroidism. PMID: 25146893
  50. Data shows that PAX8 provides signals for growth and motility of non-small cell lung cancer cells and is necessary for MET and RON expression. PMID: 24628993

Show More

Hide All

Involvement in disease
Hypothyroidism, congenital, non-goitrous, 2 (CHNG2)
Subcellular Location
Nucleus.
Tissue Specificity
Expressed in the excretory system, thyroid gland and Wilms tumors.
Database Links

HGNC: 8622

OMIM: 167415

KEGG: hsa:7849

STRING: 9606.ENSP00000395498

UniGene: Hs.469728

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*