Recombinant Human Paralemmin-1 (PALM)

In Stock
Code CSB-EP017413HU
Abbreviation Recombinant Human PALM protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PALM
Uniprot No.
Research Area
Neuroscience
Alternative Names
Paralemmin-1; KIAA0270; PALM; PALM_HUMAN; Paralemmin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-384aa
Target Protein Sequence
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human PALM was expressed with the amino acid range of 1-384. This PALM protein is expected to have a theoretical molecular weight of 45.7 kDa. Expression of this PALM protein is conducted in e.coli. The PALM coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PALM protein in following stages of expression and purification.

Paralemmin-1 (PALM) is a membrane-associated phosphoprotein that is primarily expressed in the nervous system, particularly in neurons. It belongs to the paralemmin protein family and is associated with the cell membrane, where it plays a role in membrane dynamics and neuronal functions. PALM has been implicated in processes related to neurite outgrowth, axon guidance, and synaptic plasticity. Additionally, it may be involved in the regulation of ion channels and receptor trafficking within neurons. Research on PALM often focuses on understanding its precise functions in neural development, synaptic transmission, and the overall maintenance of neuronal structure and connectivity. Insights into PALM's roles may contribute to a better understanding of neurological disorders and potential therapeutic strategies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cell projection, filopodium membrane; Lipid-anchor. Cell projection, axon. Cell projection, dendrite. Cell projection, dendritic spine. Basolateral cell membrane; Lipid-anchor. Apicolateral cell membrane; Lipid-anchor. Note=Translocation to the plasma membrane is enhanced upon stimulation of neuronal activity.
Protein Families
Paralemmin family
Tissue Specificity
Widely expressed with highest expression in brain and testis and intermediate expression in heart and adrenal gland.
Database Links

HGNC: 8594

OMIM: 608134

KEGG: hsa:5064

STRING: 9606.ENSP00000341911

UniGene: Hs.631841

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*