Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
GHYY; MGC19143; Peptide tyrosine tyrosine; peptide YY; Peptide YY like; Peptide YY precursor; Peptide YY(3-36); Prepro PYY; PYY 1; PYY; PYY II; PYY-I; PYY-II; PYY_HUMAN; PYY1; RATGHYY; Yy
Species
Homo sapiens (Human)
Expression Region
31-64aa
Target Protein Sequence
IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human PYY covers amino acids 31-64. This PYY protein is expected to have a theoretical molecular weight of 31.1 kDa. This PYY protein is produced using e.coli expression system. The PYY coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant PYY protein in following stages of expression and purification.
Human peptide YY (PYY) is a peptide hormone that plays a crucial role in appetite regulation and energy homeostasis. Produced and released by enteroendocrine cells in the gastrointestinal tract, particularly in the ileum and colon, PYY is released in response to food intake. It functions as an appetite suppressant by signaling to the brain, where it binds to Y2 receptors in the hypothalamus. The main function of PYY is to reduce appetite, slow down gastric emptying, and inhibit pancreatic secretion, collectively contributing to the feeling of satiety and the regulation of energy balance. Research on PYY often focuses on its potential as a therapeutic target for obesity and metabolic disorders. Understanding its intricate role in appetite control provides valuable insights into the complex mechanisms of energy regulation in the human body.