Recombinant Human Peptide YY protein (PYY), partial

In Stock
Code CSB-EP019128HU1
Abbreviation Recombinant Human PYY protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
GHYY; MGC19143; Peptide tyrosine tyrosine; peptide YY; Peptide YY like; Peptide YY precursor; Peptide YY(3-36); Prepro PYY; PYY 1; PYY; PYY II; PYY-I; PYY-II; PYY_HUMAN; PYY1; RATGHYY; Yy
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
31-64aa
Target Protein Sequence
IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1kDa
Protein Length
partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human PYY covers amino acids 31-64. This PYY protein is expected to have a theoretical molecular weight of 31.1 kDa. This PYY protein is produced using e.coli expression system. The PYY coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant PYY protein in following stages of expression and purification.

Human peptide YY (PYY) is a peptide hormone that plays a crucial role in appetite regulation and energy homeostasis. Produced and released by enteroendocrine cells in the gastrointestinal tract, particularly in the ileum and colon, PYY is released in response to food intake. It functions as an appetite suppressant by signaling to the brain, where it binds to Y2 receptors in the hypothalamus. The main function of PYY is to reduce appetite, slow down gastric emptying, and inhibit pancreatic secretion, collectively contributing to the feeling of satiety and the regulation of energy balance. Research on PYY often focuses on its potential as a therapeutic target for obesity and metabolic disorders. Understanding its intricate role in appetite control provides valuable insights into the complex mechanisms of energy regulation in the human body.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Gene References into Functions
  1. the current review aims to compile, evaluate and summarise current knowledge on PYY, with particular emphasis on obesity and diabetes treatment, and the importance of specific Y receptor interactions for this. PMID: 29412828
  2. Data show that peptide YY (PYY) mRNA levels were ~ 40,000-fold higher in mouse than human islets, suggesting a more important role of locally secreted Pyy in mouse islets. PMID: 29455414
  3. Data suggest that dose/intensity-response relationships exist between exercise intensity and total plasma PYY levels, though the effects on total plasma GLP1 levels and hunger perceptions seem unclear. (PYY = peptide YY ; GLP1 = glucagon-like peptide 1) PMID: 27721013
  4. Data suggest that hunger, pleasantness of eating, and prospective food intake are down-regulated in older women and this is accompanied by up-regulation of blood levels of peptide YY; both age and sex of subject appear to have independent effects on energy intake. This study was conducted in London and is reported as preliminary evidence. PMID: 27264721
  5. In extremely obese patients, fasting PYY3-36 concentrations were linked to systolic blood pressure, but not to other components of metabolic syndrome, suggesting divergence between pathways of blood pressure and glucose/body weight regulation. PMID: 27513679
  6. expression of PYY and its NPY receptors on mouse islets and immortalised rodent and human beta-cells was examined. PMID: 27465830
  7. Altogether, these results demonstrated a role of toll-like receptors in the modulation of Pyy expression and the importance of butyrate, a product of bacterial fermentation in regulation of microbial toll-like receptor-dependent sensing. PMID: 27405092
  8. Data suggest that laparoscopic sleeve gastrectomy (LSG) for morbid obesity improves insulin resistance after either fast or slow feeding/eating; these findings suggest a negligible contribution of anorexigenic gut peptides GLP1 (glucagon-like peptide 1) and PYY (peptide YY) from intestinal L cells in response to LSG-induced weight loss. PMID: 27022941
  9. Angiotensin II stimulates PYY secretion, in turn inhibiting epithelial anion fluxes, thereby reducing net fluid secretion into the colonic lumen. PMID: 27447725
  10. These findings indicate that the mechanism underlying type 2 diabetes remission may be mediated by PYY. PMID: 27117413
  11. In male GERD patients, EE was associated with significantly higher PYY levels [107.0 (55.0-120.8) vs. 32.8 (28.7-84.5) pg/ml, p = 0.026] but lower adiponectin levels [6.7 (5.6-9.3) vs. 9.9 (9.6-10.6) mug/ml, p = 0.034] than NE PMID: 26506614
  12. Data suggest that endocrine responses differ between jejunal and gastric enteral feeding, with higher peak plasma CCK (cholecystokinin), PYY (peptide YY), and GLP-1/2 (glucagon-like peptides 1/2) concentrations being attained after jejunal feeding. PMID: 26762368
  13. Data suggest that capsaicin, an appetite suppressant dietary supplement (here, administered via intraduodenal infusion), does not act via alteration of secretion of satiety hormones PYY (peptide YY) and GLP-1 (GLP-1). PMID: 26718419
  14. Data suggest that, despite effects of acute sprint interval exercise (SIE) on oxygen consumption, appetite regulation, and brief up-regulation of plasma PYY, acute SIE does not affect energy intake of young men. PMID: 25494974
  15. Plasma PYY and PP levels were significantly higher in HG [Hyperemesis gravidarum ] group. PMID: 25990478
  16. Data suggest plasma PYY (peptide YY) and GLP1 (glucagon-like peptide 1) can be regulated by digestion-resistant diet factors; intake of soluble dietary fiber (prebiotic Fibersol-2) in a tea with meal up-regulated plasma PYY/GLP1 and decreased hunger. PMID: 25823991
  17. Eating speed at breakfast did not affect postprandial ghrelin, GLP-1, PYY, hunger, and fullness values or daily energy and macronutrient intake. PMID: 25361054
  18. These results indicate that circulating PYY may have buffering effects during the early stages of smoking cessation while ghrelin may confer increased risk of smoking relapse. PMID: 25127083
  19. Data suggest secretion of PYY and GLP1 (glucagon-like peptide-1) can be altered by diet; plasma levels of PYY/GLP1 are increased during postprandial period after meal using Paleolithic diet principles (high in protein/plant matter; no cereals/dairy). PMID: 25661189
  20. Intraduodenal lipid more potently stimulated PYY release when compared to intraduodenal protein. PMID: 25568079
  21. data suggested that peptide YY expression is down-regulated by differentiation of monocytes to macrophages and proinflammatory stimuli. PMID: 24969624
  22. Although the effect size of the positive association of PYY with obesity in women is small, and potentially negligible, it may in fact represent a protective response against significant weight gain PMID: 24743402
  23. We critically discuss recent findings relating to the role of PYY in mediating the beneficial effects of bariatric surgery, the role of PYY in glucose homeostasis, the role of hepatoportal PYY in mediating its central physiological effects--{REVIEW} PMID: 24188711
  24. PYY and ghrelin are reciprocally associated during a period of weight stability, but not following weight loss PMID: 24012997
  25. PYY3-36 concentrations were suppressed in the women with High cognitive restraint PMID: 23831742
  26. We aimed to determine whether fasting or meal-stimulated ghrelin, PYY, CCK, and satiety responses are different between lean PCOS patients and healthy women. PMID: 24001751
  27. glucagon-like peptide 1 and peptide YY colocalize in primary cultured human L cells PMID: 23519462
  28. Report high densities of serotonin and peptide YY cells in the colon of patients with lymphocytic colitis. PMID: 23155335
  29. Peptide YY (PYY) is affected in several gastrointestinal diseases and disorders. Changes in PYY appear to be an adaptive response to alterations in pathophysiological conditions caused by the disease. [review] PMID: 23292145
  30. Data suggest that plasma PYY increases more after high-fat meal rather than after high-carbohydrate meal; plasma PYY is not associated with hunger or fullness; plasma PYY is not associated with energy intake. PMID: 23509106
  31. These findings underscore the important role of the NPY-Y receptor system at several levels of the gut-brain axis in which opeptide Y, peptide yy and pancreatic polypeptide operate both as neural and endocrine messengers--{REVIEW} PMID: 22979996
  32. In obese woman during caloric restriction, PPY concentrations (and pancreatic polypeptide) were greatest following liquid high-protein meals compared to high carbohydrate liquid meals. PMID: 23371976
  33. Circulating concentrations of PYY were inversely associated with circulating concentrations of ghrelin over 24 h in normal weight, premenopausal women. PYY may contribute to the modulation of the secretion of GHR in normal weight, premenopausal women. PMID: 22954902
  34. Plasma PYY levels increase both in obese adolescents and in obese adults, irrespective of eating rate; slow feeding behavior is more effective in stimulating PYY release/secretion in obese adolescents than in obese adults. PMID: 23239758
  35. review of evidence linking biosynthesis of peptide YY in strumal carcinoid of the ovary and severe constipation [CASE REPORT; REVIEW] PMID: 22563842
  36. a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin PMID: 23064014
  37. Data suggest that patients who report recent weight loss at diagnosis of major depression exhibit high levels of plasma PYY (but not plasma ghrelin or serum brain-derived neurotrophic factor); elevated PYY could contribute to reduced appetite. PMID: 22183081
  38. PYY is capable of influencing cholesterol homeostasis in intestinal Caco-2/15 cells depending on the site delivery. PMID: 22844422
  39. Examine changes in fasting total peptide YY (PYY) and ghrelin in nonobese premenopausal women after an exercise and diet program with and without weight loss. Neither fasting ghrelin nor PYY changed in response to exercise in the absence of weight loss. PMID: 21502892
  40. The R72T variant in PYY gene was not associated with obesity and most of its related anthropometric measurements. This suggests that other genes and/or environmental factors like dietary habits and lifestyle factors may be the contributors of obesity. PMID: 22303574
  41. PYY(3-36) is also present in murine as well as in human saliva PMID: 22028819
  42. The sweet taste receptors (alpha-gustducin and T1R3) are involved in glucose-stimulated secretion of GLP-1 and PYY. PMID: 21324568
  43. These data suggest that ghrelin is a physiological regulator of growth hormone (GH) in the post-oral glucose state, and the decreased ghrelin secretion could be one of the mechanisms responsible for the altered GH secretion in obesity. PMID: 21667426
  44. Data suggest that hyperphagia in Prader-Willi syndrome is not related to a lower postprandial GLP-1 or PYY response, and that elevated ghrelin levels are consistent with increased hunger and are unrelated to insulin levels. PMID: 21722955
  45. PYY varies in accordance with energy content and resting metabolism, supporting a role for PYY in energy balance modulation PMID: 21610227
  46. conclude that the C-terminal helix is crucial for the structural integrity of PYY PMID: 21360523
  47. higher levels of PYY are associated with disordered eating psychopathology independent of BMI in women across the weight spectrum PMID: 21098684
  48. postprandial PYY secretion is not affected by glycemic load but is blunted in obese black women compared with normal weight black women and with white women PMID: 19875990
  49. Several LEP, and NPY2R and PYY SNPs were associated with obesity-related phenotypes in young adults, particularly among African-Americans. PMID: 20642810
  50. During mid-puberty, at a time when growth hormone levels are the highest, PYY is at a nadir, and these low PYY levels may facilitate pubertal progression and growth PMID: 20375207

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
NPY family
Database Links

HGNC: 9748

OMIM: 600781

KEGG: hsa:5697

STRING: 9606.ENSP00000353198

UniGene: Hs.169249

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*