Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Transcription
Alternative Names
B lymphoma Mo MLV insertion region (mouse); B lymphoma Mo MLV insertion region 1 homolog; Bmi 1; BMI1; BMI1 polycomb ring finger oncogene; BMI1_HUMAN; Flvi 2/bmi 1; FLVI2/BMI1; MGC12685; Murine leukemia viral (bmi 1) oncogene homolog; Oncogene BMI 1; PCGF 4; PCGF4; Polycomb complex protein BMI 1; Polycomb complex protein BMI-1; Polycomb group protein Bmi1; Polycomb group ring finger 4; Polycomb group RING finger protein 4; RING finger protein 51; RNF 51; RNF51
Species
Homo sapiens (Human)
Expression Region
1-250aa
Target Protein Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human BMI1 contains amino acids 1-250. This BMI1 protein is expected to have a theoretical molecular weight of 56.4 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of BMI1, making it easier to detect and purify the BMI1 recombinant protein in the later stages of expression and purification.
The human polycomb complex protein BMI1 is a vital component of the polycomb repressive complex 1 (PRC1), crucial for epigenetic gene regulation. Its main function involves the transcriptional repression of target genes, influencing cellular processes like cell cycle regulation and stem cell maintenance. BMI1's role in inhibiting the tumor suppressor p16INK4a highlights its significance in controlling cell proliferation. In research, BMI1 is explored for its implications in cancer, stem cell biology, and developmental processes. Understanding BMI1's functions provides insights into epigenetic mechanisms, with potential applications in cancer therapeutics and regenerative medicine.