Recombinant Human Pre-mRNA-splicing factor SPF27 (BCAS2)

In Stock
Code CSB-EP002597HU
Abbreviation Recombinant Human BCAS2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BCAS2
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
bcas2; Breast carcinoma amplified sequence 2; Breast carcinoma-amplified sequence 2; DAM 1; DAM-1; DAM1; DNA amplified in mammary carcinoma 1 protein; MGC7712; Pre mRNA splicing factor SPF27; Pre-mRNA-splicing factor spf27; Snt309; SPF27; SPF27_HUMAN; Spliceosome associated protein amplified in breast cancer; Spliceosome associated protein SPF 27; Spliceosome-associated protein SPF 27
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-225aa
Target Protein Sequence
MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene coding for the Human BCAS2 protein (1-225aa) is introduced into a plasmid vector, creating recombinant plasmid that is subsequently transformed into e.coli cells. e.coli cells capable of surviving in the presence of a specific antibiotic are selected and then cultured under conditions favorable for the expression of the gene of interest. A N-terminal GST tag is attached to the protein. Post-expression, the recombinant Human BCAS2 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Human BCAS2 protein, revealing a purity exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for pre-mRNA splicing as component of the activated spliceosome. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).
Gene References into Functions
  1. Study showed that CDK4 and BCAS2 may be target genes of miR-486 and levels of CDK4 and BCAS2 were both significantly higher in the esophageal cancer tissues and cell lines than levels in the normal tissues and cells. PMID: 29115564
  2. Chromosomal breakpoints involved the BCAS2 gene in 1q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
  3. BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination. PMID: 26319152
  4. These results demonstrate that Aurora B inhibits both direct interaction with the microtubule and oligomerization of the Dam1 complex to drive error correction during mitosis. PMID: 26560693
  5. BCAS2 is a novel androgen receptor-interacting protein. PMID: 25461807
  6. ERRbeta signalling leads to BCAS2-mediated blockage of the G1/S transition and inhibition of the epithelial to mesenchymal transition through FST-mediated regulation of E-cadherin PMID: 24667650
  7. The BCAS2 gene was amplified in two of 60 primary breast cancer tissues, but not in other cancer cells, providing the first evidence of amplification within this region and indicating that BCAS2 gene codes for a nuclear protein. PMID: 12169396
  8. This study suggested that BCAS2 might play an important role in breast cancer development by increasing the estrogen receptor's function. PMID: 15694360
  9. BCAS2 directly interacts with p53 to reduce p53 transcriptional activity by mildly but consistently decreasing p53 protein in the absence of DNA damage. In the presence of DNA damage, BCAS2 prominently reduces p53 protein. PMID: 19903847

Show More

Hide All

Subcellular Location
Nucleus. Nucleus, nucleolus.
Protein Families
SPF27 family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 975

OMIM: 605783

KEGG: hsa:10286

STRING: 9606.ENSP00000358554

UniGene: Hs.22960

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*