Recombinant Human Prohibitin(PHB)

Code CSB-EP017885HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names PHB
Uniprot No. P35232
Research Area Transcription
Alternative Names Epididymis luminal protein 215; Epididymis secretory sperm binding protein Li 54e; HEL 215; HEL S 54e; PHB; PHB_HUMAN; PHB1; Prohibitin
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-272aa
Target Protein Sequence MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 33.8kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.
Gene References into Functions
  1. prohibitin is an important negotiator protein that regulates dopaminergic cell death in substantia nigra and their protection in ventral tegmental area in Parkinson's Disease. PMID: 28062948
  2. Results show that PHB expression is significantly increased in metastatic prostate cancer and represents a strong marker predicting survival, along with ALDH6A1 and HSP27. PMID: 30396985
  3. Data suggest that prohibitin (PHB) plays a crucial role in integrating cell signaling events with metabolic switches, and may serve as a potential target for cancer immunotherapeutic [Review]. PMID: 29222040
  4. prohibitin 1 regulates tumor cell apoptosis via the interaction with X-linked inhibitor of apoptosis protein PMID: 27025967
  5. Up regulation of PHB in relapsing vs remission MS patients imply the potential use of PHB to clinically evaluate subclinical disease status towards prognosis of an oncoming relapse PMID: 29242126
  6. Study gives attention to the functional role and regulatory mechanism of PHB proteins in cardiovascular health and diseases (VCD) and its associated implications. Various molecular pathways involved in PHB function and its regulation are analyzed. In neoplasm, PHB is shown to act through many mechanisms by acting as oncogene, tumor suppressor, antioxidant, antiapoptotic, in angiogenesis, autophagy etc. [review] PMID: 27557820
  7. This study support the role of miR-195 as anti-proliferative miRNA via targeting of PHB1 in melanoma cells PMID: 29126391
  8. Data (including data from studies using knockout mice) suggest that cell surface-expressed PHB is involved in Enterovirus 71 entry into neuronal cells; mitochondrial membrane-bound PHB associates with virus replication complex and facilitates viral replication. PMID: 29324904
  9. The G to A transition but not the C-to-T transition in the 3'-UTR of prohibitin was associated with an increased risk of gastric cancer in Chinese population. PMID: 28294412
  10. Case Report: imbalance between ROS and antioxidants together with failure of signal transduction in the glomerular slit membrane caused by prohibitin 2 abnormality could have contributed to nephrotic syndrome. PMID: 27812762
  11. Study elucidates an important role of PHBP1 in promoting esophageal squamous cell carcinoma partly via increasing PHB expression. PMID: 28404970
  12. Endoplasmic reticulum resident chaperone GRP78, mitochondrial protein Prohibitin and heterogeneous nuclear ribonucleoprotein hnRNPC (C1/C2) have been shown to interact with viral RNA. Hence it is proposed that these are the principle candidates governing endoplasmic reticulum stress-induced apoptosis in JEV infection. PMID: 28102850
  13. PHB1 down regulation suppresses liver cancer and bile duct cancer tumorigenesis. PMID: 27981602
  14. PHB has an unexpected nuclear role in human embryonic stem cells that is required for self-renewal and that it acts with HIRA in chromatin organization to link epigenetic organization to a metabolic circuit. PMID: 27939217
  15. results demonstrate that the H19-Igf2 axis is negatively regulated by CTCF-PHB1 cooperation and that H19 is involved in modulating the growth-suppressive effect of PHB1 in the liver. PMID: 27687727
  16. PHB promotes AR activation in ER-positive breast cancer. PMID: 28272969
  17. High PHB expression is associated with breast cancer. PMID: 27485113
  18. Data shows that PHB protein was overexpressed in gallbladder cancer tissues and significantly associated with histological grade, tumor stage and perineural invasion. PMID: 27084680
  19. The present review focus is on recent developments in prohibitin (PHB) research in relation to ovarian granulosa cells physiological functions. [review] PMID: 26496733
  20. We propose a model whereby in analogy to previous findings (e.g., the RAS-RAF signalling pathway), PHB can act as a signalling scaffold protein to assist in KDELR-dependent Src activation PMID: 26064897
  21. a majority of patients with IgG4-related disease have antibodies against prohibitin. PMID: 25932630
  22. PHB phosphorylated at threonine 258 and MIG-7 may play complementary roles in the initiation and sustainment of the effects of growth factors and COX-2/PGE2 on cancer invasion/metastasis. PMID: 25575814
  23. miR-27a was shown to be a significant tumor suppressor by targeting and decreasing PHB protein expression in glioma U251 cells. miR-27a targeting of PHB may be a novel potential therapeutic strategy for glioma PMID: 25777779
  24. Less expression of prohibitin is associated with increased paired box 2 in renal interstitial fibrosis PMID: 22949832
  25. A protective role of PHB that is dependent on pS727-Stat3 to prevent mitochondrial dysfunction in intestinal epithelial cells. PMID: 24975845
  26. Knockdown of prohibitin expression promotes glucose metabolism in eutopic endometrial stromal cells from women with endometriosis. PMID: 25444511
  27. we have provided a modified method for isolating and identifying membrane proteins and demonstrated that PHB1 may be a promising biomarker for early diagnosis and therapy of pancreatic (and potentially other) cancers. PMID: 25344214
  28. PHB lies downstream of ERalpha and mediates estrogen-dependent Paclitaxel resistance signaling cascades PMID: 24376711
  29. The study suggest that the tumor suppressing action of prohibitin is probably associated with luteinizing hormone mediated protection role against ovarian epithelial carcinoma. PMID: 24966933
  30. The T allele of the rs6917 polymorphism was associated with reduced PHB mRNA levels. PMID: 24879411
  31. Findings provide new insights into the function of prohibitin in transcriptional regulation and uncover a BASP1-prohibitin complex that plays an essential role in the PIP2-dependent recruitment of chromatin remodeling activities to the promoter. PMID: 24166496
  32. Vi released by Salmonella typhi interacts with the membrane prohibitin complex and inhibits IL-2 secretion from T cells stimulated through the T-cell receptor (TCR). PMID: 24470505
  33. PHB expression was crucial for maintenance of oncogenic ERK-driven pancreatic tumorigenesis PMID: 24568222
  34. Results of the present study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells PMID: 24402549
  35. Amplification at 17q21.33 is a recurrent feature of breast cancer that forms part of a 'firestorm' pattern of genomic aberration. PHB is not a driver of amplification, however PHB may contribute to high grade breast cancer. PMID: 24247619
  36. Persistent PAR1 signaling due to the absence of membrane PHB and decreased PAR1 degradation caused by the upregulation of intracellular PHB in cancer cells may render them highly invasive. PMID: 24732013
  37. The different subcellular localization of PHB1 in non-small cell lung cancer cells and the loss of the membrane-associated PHB1 probably related to the tumorigenesis and progression of NSCLC. PHB1 may play different roles in various types of NSCLC. PMID: 24133587
  38. Prohibitin is regulated by miR-26a and promotes glioma progression and angiogenesis. PMID: 23870455
  39. Prohibitin may be associated with breast cancer. PMID: 23715748
  40. Studies indicate that in response to stimulation with antigen, PHB1 translocated to plasma membrane lipid rafts to form a ternary complex with the high-affinity IgE receptor FcepsilonRIgamma and the nonreceptor tyrosine kinase Syk. PMID: 24023253
  41. prohibitin and prohibiton (PHB2) contribute to PIG3-mediated apoptosis by binding to the PIG3 promoter (TGYCC)15 motif PMID: 24388982
  42. These results suggest that the altered localization and expression of PHB, as well as its co-localization with related oncogenes and tumor suppressor genes, can affect the apoptosis of Mz-ChA-1 cells. PMID: 24380853
  43. Our data suggest that miR-27 is an anti-adipogenic microRNA partly by targeting prohibitin and impairing mitochondrial function. PMID: 24133204
  44. Decreased expression of prohibitin protein is closely associated with poor prognosis and metastasis in nasopharyngeal carcinoma. PMID: 22728421
  45. PHBs are localized on the human platelet membrane and are involved in PAR1-mediated platelet aggregation. PMID: 22212092
  46. Here, we review the signal transduction pathways of PHB and its role in the pathogenesis of diseases. PMID: 23327602
  47. Calreticulin and prohibitin were identified to be novel candidate biomarkers for adrenocortical carcinomas. PMID: 23587357
  48. Six investigations were identified for the analysis of association between the prohibitin 3' untranslated region C > T gene polymorphism and cancer risk. PMID: 22994754
  49. Missense mutation in prohibitin may be associated with breast tumor development and/or progression. PMID: 23244120
  50. In schizophrenia, there were significantly more prohibitin-expressing oligodendrocytes in the right dorsolateral white matter area, suggesting involvement in mitochondrial and/or cell-cycle dysfunction. PMID: 22711522

Show More

Hide All

Subcellular Location Mitochondrion inner membrane
Protein Families Prohibitin family
Tissue Specificity Widely expressed in different tissues.
Database Links

HGNC: 8912

OMIM: 176705

KEGG: hsa:5245

STRING: 9606.ENSP00000300408

UniGene: Hs.514303

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1