Recombinant Human Protein S100-A11 (S100A11)

In Stock
Code CSB-EP020624HU
Abbreviation Recombinant Human S100A11 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Calgizzarin; Epididymis secretory protein Li 43; HEL S 43; Metastatic lymph node gene 70 protein; MLN 70; MLN70; Protein S100 A11; Protein S100-A11; Protein S100-A11, N-terminally processed; Protein S100-C; Protein S100A11; Protein S100C; S100 A11; S100 calcium binding protein A11; S100 calcium-binding protein A11 (calgizzarin); S100 calcium-binding protein A11; S100a11; S100C; S10AB_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-105aa
Target Protein Sequence
AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Protein S100-A11 (S100A11) gets expressed in E. coli and spans the full length of the mature protein from amino acids 2 to 105. The protein carries an N-terminal 6xHis-SUMO tag to help with purification and detection. SDS-PAGE analysis shows purity levels above 90%, which appears to deliver reliable results for research work. This product is meant for research use only.

S100A11 belongs to the S100 protein family and is known for its calcium-binding capabilities. The protein seems to play a role in both intracellular and extracellular regulatory activities, taking part in pathways that control cell growth and differentiation. Researchers studying cellular processes and signal transduction often find S100A11 particularly interesting, given its involvement in multiple cellular pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag allows for efficient purification and immobilization of recombinant S100A11 on nickel-affinity resins during pull-down experiments. This method may help identify and characterize potential binding partners of S100A11 in cell lysates or with purified candidate proteins. The high purity (>90%) likely reduces background binding from contaminants during interaction studies. The full-length mature protein (aa 2-105) appears to preserve the native structure needed for authentic protein-protein interactions.

2. Antibody Development and Validation

This recombinant S100A11 could work as an immunogen for generating specific antibodies against human S100A11 or as a standard for validating existing antibodies. The E. coli expression system produces protein without human post-translational modifications, which makes it suitable for developing antibodies that recognize the core protein sequence. The 6xHis-SUMO tag can be used in ELISA-based screening assays to identify high-affinity antibodies during hybridoma selection or phage display campaigns.

3. Biochemical Characterization and Structural Studies

The purified recombinant protein enables detailed biochemical analysis. This includes determining oligomerization states, thermal stability, and calcium-binding properties that are characteristic of S100 family proteins. SDS-PAGE analysis can monitor protein stability under different buffer conditions and temperatures. The high purity level makes this protein suitable for biophysical techniques such as dynamic light scattering, circular dichroism spectroscopy, or analytical ultracentrifugation to study protein folding and conformational changes.

4. In Vitro Functional Assays and Enzyme Activity Studies

This recombinant S100A11 may work as a substrate or cofactor in cell-free biochemical assays to study its role in various cellular processes. Researchers can incorporate the protein into reconstituted systems to examine its effects on other proteins or enzymatic activities. The SUMO tag provides an additional purification handle and can be removed by SUMO protease if native protein is required for specific functional studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Facilitates the differentiation and the cornification of keratinocytes.
Gene References into Functions
  1. Our present study indicated that S100A11 promotes EMT through accumulation of TGF-beta1 expression, and TGF-beta1-induced upregulation of p-SMAD2 and 3. PMID: 29569474
  2. Results show that S100A11 expression is up-regulated by BC200 through stabilizing its mRNA and that S100A11 critically mediates the ability of BC200 RNA to induce cancer cell migration and invasion. PMID: 28277927
  3. identified as a new regulator of Aldo-induced collagen production in human cardiac fibroblasts. PMID: 28739510
  4. Furthermore, we identify flotillin-1 (FLOT1) and histone H1 as downstream factors for cytoplasmic and nuclear pathway of S100A11, which are required for LASP1-S100A11 axis-mediated epithelial-mesenchymal transition and colorectal cancer progression. PMID: 27181092
  5. In patients with rheumatoid arthritis, S100A11 is up-regulated and is associated with inflammation and disease activity. PMID: 28446208
  6. S100A11 overexpression correlates with an aggressive malignant phenotype and may constitute a novel prognostic factor for HGSC PMID: 26574635
  7. we studied S100A11 and noted knockdown of S100A11 using short hairpin RNA, which inhibited proliferation, invasion, and migration of renal carcinoma cells as well as increased expression of E-cadherin and decreased expression of epidermal growth factor receptor/Akt in renal carcinoma cells. Therefore, S100A11 may be a key molecular target for treating renal carcinoma. PMID: 28513300
  8. higher S100A11 expression was associated with statistically significant decrease in disease-free survival in clear cell renal cell carcinoma PMID: 26472670
  9. the up-regulation of S100A11 plays a role in tumor progression, particularly in KRAS-mutated lung adenocarcinomas PMID: 26544866
  10. metastatic cancer cells have elevated rate of cell injury and they rely on the S100A11-ANXA2 complex to enable cell membrane repair. S100A11 in a complex with Annexin A2 helps reseal the plasma membrane. PMID: 24806074
  11. All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis. PMID: 22430872
  12. The EGFRvIII-STAT3 pathway promotes cell migration and invasion by upregulating S100A11 in hepatocellular carcinoma. PMID: 24376686
  13. Proteomic data suggest a limited protein set is involved in SET- (template activating factor-I-) mediated cytotoxicity of TCE (trichloroethylene) in hepatocytes; this set includes CFL1 (cofilin 1), PRDX2 (peroxiredoxin 2), and S100-A11 (calgizzarin). PMID: 24631019
  14. Our data indicate that S100A11 overexpression exerts a protumoral functional role in papillary thyroid carcinoma pathogenesis. PMID: 23928665
  15. Data suggest that S100A11 is involved in maintenance of p21-CIP1 (cyclin-dependent kinase inhibitor 1A) protein stability (up-regulation; down-regulation) and appears to function as inhibitor of apoptosis in keratinocytes. PMID: 23745637
  16. the structure of human calcium-bound S100A11. PMID: 22903637
  17. Endometrial S100A11 is a crucial intermediator in EGF-stimulated embryo adhesion, endometrium receptivity, and immunotolerance via affecting Ca2+ uptake and release from intracellular Ca2+ stores. PMID: 22869607
  18. Using transcriptional signatures of blood samples,identified S100A11 as a potential diagnostic marker of infective endocarditis, and AQP9 as a potential prognostic factor. PMID: 22319637
  19. The expression level of S100C in lung cancer tissue was lower than that in ambient tissue. PMID: 18589612
  20. investigated S100A11 expression in various subtypes of lung cancer and explored its role in cell proliferation. PMID: 21861103
  21. S100A11 mediates HIMF-induced smooth muscle cell migration, vesicular exocytosis, and nuclear activation. PMID: 21139050
  22. Data support that S100A11 is a novel diagnostic marker in breast carcinoma. PMID: 20372844
  23. S100C is a new tumor marker protein, the expression of which significantly decreases after malignant transformation of human tissues. PMID: 11873942
  24. S100Cis a key mediator of the Ca(2+)-induced growth inhibition of human keratinocytes in culture, and may be mediate growth regulation in vivo as well. PMID: 14623863
  25. that redistribution along microtubules is a mechanism whereby S100A11 is positioned at the cell periphery in preparation for transglutaminase-dependent crosslinking. PMID: 14962086
  26. Up-regulation of S100A11 was associated with the development of lymph node metastases in gastric cancer PMID: 15138568
  27. Of several tested, only an N-terminal peptide with 19 amino acid residues induces apoptosis in human keratinocyte and squamous-cell carcinoma cell lines PMID: 15241500
  28. findings suggest that S100A11 has an anti-apoptotic function and is related to the process of growth of human uterine leiomyoma PMID: 15322223
  29. Down-regulation of S100C is associated with bladder cancer progression PMID: 15701847
  30. Expression of S100A11, a putative tumor suppressor gene, is increased in the early stage of pancreatic carcinogenesis and decreased during subsequent progression to cancer. PMID: 17000675
  31. S100C/A11-mediated pathway is at least partly involved in conferring upon human squamous cell cancers resistant to TGFbeta-induced growth suppression PMID: 17476473
  32. The results indicated that the upregulation of S100A11 expression in non-small cell lung cancer tissues was significantly associated with higher tumor-node-metastasis stage (P = 0.001) and positive lymph node status PMID: 17537172
  33. Proteomic mapping using a selective subcellular extraction kit revealed S100A11 as a new member of the S100 protein family modulated by glucocorticoids in keratinocytes. PMID: 17624315
  34. Ca(2+)-dependent binding of S100A11 to ANXA1 facilitated the binding of the latter to cPLA(2), resulting in inhibition of cPLA(2) activity PMID: 17932043
  35. These findings indicate that S100A11 plays a dual role in growth regulation of epithelial cells. PMID: 17978094
  36. These findings suggest S100A11 could be helpful in the pathological study of colorectal cancer, especially for the classification of different stages in colorectal cancer. PMID: 18340452
  37. S100/A11 and p21 gene expression was also found to be significantly lower in acute and chronic atopic dermatitis skin. PMID: 18385759
  38. S100A11 targets Rad54B to sites of DNA DSB repair sites and has a role in p21-based regulation of cell cycle PMID: 18463164
  39. Following transformation by transglutaminase 2, S100A11 acquires the capacity to signal through the p38 MAP kinase pathway, accelerate chondrocyte hypertrophy, and couple inflammation with chondrocyte activation to promote progression of osteoarthritis. PMID: 18523305
  40. Phosphorylation of S100A11 induces a structural perturbation in the N-terminal edge of helix 1 and enables the phosphoryl group to be exposed to the solvent, allowing it to be recognized by the binding partner, nucleolin. PMID: 18618420
  41. S100A11 differentially expressed in primary hepatocellular carcinoma , primary colorectal, and liver PMID: 19048101
  42. Inhibition of S100A11 gene expression impairs the ability of keratinocytes to control vaccinia virus replication via downregulation of IFN-lambda receptor IL-10R2. PMID: 19577285
  43. Down-regulation of S100C expression is associated with increasing tumor aggressiveness and poor prognosis in bladder cancer patients. PMID: 15701847

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
S-100 family
Database Links

HGNC: 10488

OMIM: 603114

KEGG: hsa:6282

STRING: 9606.ENSP00000271638

UniGene: Hs.417004

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*