Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2), partial

Code CSB-MP815565HU2
Abbreviation Recombinant Human SFTPA2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SFTPA2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
PSP-A;PSPA;SP-A;SP-A2;35 kDa pulmonary surfactant-associated protein;Alveolar proteinosis protein;Collectin-5
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
141-248aa
Target Protein Sequence
SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.0 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2) is produced using a mammalian cell expression system and comes with a C-terminal hFc1 tag. This partial protein covers amino acids 141-248. SDS-PAGE analysis confirms the purity level exceeds 85%. The protein is designed for research use only, though no specific endotoxin level data appears to be available.

Pulmonary surfactant-associated protein A2 seems to play a crucial role in maintaining surfactant balance and supporting immune defense in the lungs. It's considered a key component of the pulmonary surfactant system, helping to reduce surface tension in the alveoli while participating in innate immune responses. Understanding this protein may prove vital for respiratory physiology research and disease studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant SFTPA2 protein fragment are unknown and must be considered highly uncertain. SFTPA2 is a member of the collectin family, and its function critically depends on the correct folding of its C-terminal carbohydrate recognition domain (CRD) and the formation of higher-order oligomeric structures (trimers and larger multimers). The protein is expressed as a partial fragment (141-248aa), which corresponds primarily to the CRD but lacks the N-terminal collagen-like domain that is essential for the native quaternary structure and full function. Expression in a mammalian system is favorable for disulfide bond formation in the CRD, but the large C-terminal hFc1 tag is highly likely to sterically interfere with the CRD's ligand-binding site and prevent proper oligomerization. Therefore, it is highly improbable that this protein is correctly folded into a bioactive conformation that replicates native SFTPA2 function. Applications relying on specific biological interactions are not feasible without validation.

1. Antibody Development and Validation Studies

This recombinant SFTPA2 fragment is suitable for use as an immunogen to generate antibodies. The mammalian expression system may promote correct disulfide bonding within the CRD. Antibodies generated will be against this truncated, Fc-tagged fragment. Their ability to recognize the complex, oligomeric structure of full-length, native SFTPA2 in lung surfactant is very low and must be rigorously validated. The protein is most reliable for developing antibodies that detect denatured SFTPA2 (e.g., in Western blots) or the recombinant human SFTPA2 protein itself.

2. ELISA-Based Quantitative Assays

The hFc1-tagged protein can be used in ELISA. However, it is critically important to understand its severe limitation: it is not suitable for measuring SFTPA2 levels in biological samples. An ELISA built with this recombinant SFTPA2 protein would only detect the fragment or antibodies against it. It would not accurately quantify the native, oligomeric full-length SFTPA2 present in bronchoalveolar lavage fluid, as the epitopes are completely different. Its use should be restricted to detecting antibodies against the immunogen.

3. Biochemical Characterization and Stability Studies

This purified recombinant fragment is well-suited for basic biochemical characterization of the isolated CRD domain. Studies on its thermal stability, glycosylation, and protease sensitivity can be performed. This application is valid for studying the properties of this specific recombinant SFTPA2 fragment, not the full-length, oligomeric native protein.

Final Recommendation & Action Plan

The unequivocal recommendation is to restrict the use of this recombinant SFTPA2 protein lot to applications that do not depend on native oligomeric structure or function. It can be used for generating antibodies against linear epitopes of the CRD (Application 1, with the stated limitations) and for characterizing the biophysical properties of the isolated, tagged CRD fragment itself (Application 3). The recombinant SFTPA2 fragment lacks the collagen-like domain necessary for native oligomerization, and the Fc tag will likely block the CRD's binding site. So protein-protein interaction studies and functional studies must be abandoned entirely, as they will produce biologically meaningless and misleading data. For any functional studies related to SFTPA2 (e.g., pathogen binding, surfactant interactions), a full-length protein without a large C-terminal tag, expressed in a system conducive to correct oligomerization, is essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.
Gene References into Functions
  1. SP-A1 6A4 and SP-A2 1A5 genetic variants may influence the susceptibility to respiratory distress syndrome in late-preterm infants, independently of the effect of other perinatal factors. PMID: 27835691
  2. Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected. PMID: 26950992
  3. In a Dutch cohort study of unrelated patients with idiopathic or familial interstitial pneumonia genetic analysis of SFTPA2 three new mutations in exon 6 of SFTPA2: N210T, G231R, and N171Y were identified. None were found in the control group. PMID: 26568241
  4. Investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates. PMID: 26061924
  5. Expression of SFTPA2 mRNA and total SP-A protein was significantly lower in cancer tissue. PMID: 25514367
  6. In this study, the loci and haplotypes associated with pulmonary tuberculosis (PTB) were found mostly to be located in the SFTPA2 gene, suggesting that the effects of the SFTPA2 gene on PTB are stronger than those of SFTPA1. PMID: 24984162
  7. Genetic variation in SP-A2 leads to differential binding to Mycoplasma pneumoniae membranes and regulation of host responses. PMID: 25957169
  8. data suggest an effect of genetic variants of SFTPA2 on the severity of pandemic H1N1 infection PMID: 24950659
  9. This study shows that changes occur in the alveolar macrophage proteome in response to a single in vivo treatment with exogenous SP-A1 and/or SP-A2. PMID: 24954098
  10. In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions. PMID: 24960334
  11. sequence variability at the 3'UTR of SFTPA1 and SFTPA2 gene variants differentially affects miRNA regulation of gene expression. PMID: 24793167
  12. The aim of this report is to describe the genetic complexity of the SFTPA1 and SFTPA2 genes, as well as to review regulatory mechanisms that control SP-A expression in humans and other animal species.[review] PMID: 23069847
  13. findings show rs1650232 is in partial linkage disequilibrium with known SP-A2 marker single-nucleotide polymorphisms previously associated with risk for respiratory diseases including tuberculosis PMID: 23328842
  14. proteins including the 14-3-3 family bind two cis-elements within exon B of hSP-A2 mRNA in a sequence- and secondary structure-specific manner. PMID: 23525782
  15. SP-A2 G231V and F198S mutants impair the dimmer/trimer assembly, which contributes to the protein sialylation and secretion deficiency. The intracellular protein mutants could be partially degraded through the proteasome pathway and formed aggregates PMID: 23056344
  16. Surfactant protein A associated with respiratory distress syndrome in Korean preterm infants: evidence of ethnic difference. PMID: 23038062
  17. The untranslated exon B of human surfactant protein A2 mRNAs is an enhancer for transcription and translation. PMID: 21840962
  18. there is an association of risk for severe acute respiratory syncytial infection in variant forms of the surfactant protein A2 allele PMID: 21601013
  19. These results indicate that the gene polymorphism at the residue 223 in the carbohydrate recognition domain of SFTPA2 may be a genetic marker for the development of allergic rhinitis in the adult Chinese Han population. PMID: 20963503
  20. The mechanism of pulmonary fibrosis does not involve an overt lack of secreted SP-A but instead involves an increase in endoplasmic reticulum stress of resident type II alveolar epithelial cells. PMID: 20466729
  21. Observational study of gene-disease association. (HuGE Navigator) PMID: 20448439
  22. Electron microscopy analysis revealed that hTG mice with a single SP-A1(6A(4)) or SP-A2(1A(3)) gene product lacked tubular myelin (TM), but hTG mice carrying both had TM. PMID: 20048345
  23. SP-A2 polymorphisms are associated with the severity of respiratory syncytial virus infection in infants PMID: 19914637
  24. Decreased levels of SP-A and SP-D have been measured in bronchoalveolar lavage fluid of these patients, as well as patients with acute pneumonia but no chronic lung disease. (review) PMID: 16406431
  25. We conclude that SP-A permeabilizes phospholipid membranes in an LPS-dependent and rough LPS-specific manner, that the effect is neither SP-A- nor species-specific, and that oxidative damage to SP-A abolishes its membrane destabilizing properties PMID: 16489761
  26. Residue 85 plays an important role in the structure and function of SP-A and is a major factor for the differences between SP-A1 and SP-A2 variants. PMID: 17580966
  27. TTF-1 response element is critical for temporal and spatial regulation and necessary for hormonal regulation of human surfactant protein-A2 promoter activity PMID: 18487360
  28. The amniotic fluid concentration of SP-A decreases in spontaneous human parturition at term. PMID: 18828058
  29. These data are consistent with SFTPA2 germline mutations that interfere with protein trafficking and cause familial IPF and lung cancer. PMID: 19100526
  30. SP-A1 and SP-A2, in addition to their roles in surfactant-related functions, play an important role in the modulation of lung host defense. PMID: 19392648
  31. Observational study of gene-disease association. (HuGE Navigator) PMID: 16385451
  32. Observational study of gene-disease association. (HuGE Navigator) PMID: 19543369
  33. Observational study of gene-disease association. (HuGE Navigator) PMID: 18983439

Show More

Hide All

Involvement in disease
Pulmonary fibrosis, idiopathic (IPF)
Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
Protein Families
SFTPA family
Database Links

HGNC: 10799

OMIM: 178500

KEGG: hsa:729238

STRING: 9606.ENSP00000361400

UniGene: Hs.523084

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*