Recombinant Human Putative endogenous retrovirus group K member 11-1 Env polyprotein (ERVK11-1)

In Stock
Code CSB-EP350358HU
Abbreviation Recombinant Human ERVK11-1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ERVK11-1
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-191aa
Target Protein Sequence
MPGAIDDHCPAQPGEEGTAFNVTMGYKYPPLCLGHATRCIHLETQVWAAYLLERLATGKWGHLVSGLSLCPLRQMKRGVIGDTPYFQYKPVGKLCPKNFEGPSKTLIWGDCVNSHAVVLKNDSYALVIDWAPKGYLKNTCSSGGGEFLEATYFISYWEDEDHHPTLHRWFGSFFTLKWEDKDITLHPQGLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Putative endogenous retrovirus group K member 11-1 Env polyprotein (ERVK11-1) gets expressed in E. coli and includes the complete sequence spanning amino acids 1 to 191. A C-terminal 6xHis-tag has been added to the protein, which makes purification and detection more straightforward. SDS-PAGE analysis shows purity levels above 85%, suggesting this preparation should work reliably for research purposes.

The ERVK11-1 Env polyprotein comes from an endogenous retrovirus group K that's already integrated into human DNA. Scientists find this protein intriguing because it may play a role in different cellular processes and carries evolutionary importance. Studying proteins like this one could help us understand how endogenous retroviral elements might influence human biology and what roles they potentially play in health and disease.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The human ERVK11-1 is a viral envelope protein that typically requires complex folding, disulfide bond formation, and glycosylation for bioactivity (e.g., receptor binding or membrane fusion). E. coli, as a prokaryotic expression system, lacks eukaryotic chaperones and cannot perform glycosylation or proper disulfide bond formation for such proteins. The C-terminal His tag may not directly interfere with folding, but the absence of post-translational modifications and the prokaryotic environment make correct folding unlikely. Without experimental validation, the protein is probably misfolded and inactive. The high purity indicates low impurities, but does not guarantee native conformation.

1. Antibody Development and Immunological Studies

This recombinant ERVK11-1 protein can be used as an immunogen for generating antibodies targeting linear epitopes, as antibody production often tolerates some misfolding. The His tag facilitates purification and immobilization for ELISA-based screening. However, antibodies generated may not recognize native, correctly folded ERVK11-1 in physiological contexts (e.g., in human tissues) due to conformational differences. Validate antibody specificity against native ERVK11-1 or full-length proteins from eukaryotic expression systems.

2. Protein-Protein Interaction Studies

Use with caution. The His tag enables pull-down assays, but if the protein is misfolded, interactions may be non-physiological or tag-mediated. Any identified binding partners must be validated using native ERVK11-1 (e.g., from mammalian cells) to ensure relevance. Without a folding confirmation, results could be misleading.

3. Biochemical Characterization and Stability Studies

Suitable for basic biophysical analyses (e.g., circular dichroism for secondary structure, dynamic light scattering for aggregation state). However, data may not reflect the native protein's properties due to potential misfolding and lack of glycosylation. Avoid extrapolating to functional mechanisms without activity validation.

4. ELISA-Based Detection Assay Development

This protein can be used as an antigen in ELISA to detect ERVK11-1-specific antibodies, as linear epitopes may be accessible. However, if the protein is misfolded, it may not accurately mimic native ERVK11-1, leading to false negatives/positives in clinical samples. Validate assays with native proteins or patient sera for reliability.

Final Recommendation & Action Plan

Before using this recombinant ERVK11-1 for any application, prioritize experimental validation of its folding and potential bioactivity. Start with biophysical assays (e.g., circular dichroism to check secondary structure, size-exclusion chromatography to monitor oligomerization) to assess folding status. If possible, perform functional tests (e.g., receptor-binding assays) though bioactivity is unlikely in E. coli-expressed protein. For antibody development, proceed but validate antibodies against eukaryotic-expressed ERVK11-1. Avoid interaction studies without folding confirmation. For reliable results, consider expressing ERVK11-1 in a eukaryotic system (e.g., mammalian cells) to ensure proper folding and modifications. Always include appropriate controls to account for folding limitations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution.
Subcellular Location
Virion.
Protein Families
Beta type-B retroviral envelope protein family, HERV class-II K(HML-8) env subfamily
Tissue Specificity
Cerebellum and testis.
Database Links

HGNC: 43647

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*