Recombinant Human RING finger protein 11 (RNF11)

Code CSB-BP019816HU
Abbreviation Recombinant Human RNF11 protein
MSDS
Size $472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
RNF11
Uniprot No.
Research Area
Cell Biology
Alternative Names
CGI 123; RING finger protein 11; RNF11; RNF11_HUMAN; Sid 1669; SID1669
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
2-154aa
Target Protein Sequence
GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 9xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.
Gene References into Functions
  1. data suggest for the first time that the choice of binding partners for SMURF2 can sustain or repress TGFbeta signaling, and RNF11 may promote TGFbeta-induced cell migration. PMID: 28292929
  2. Up-regulation of COPII components requires the transcriptional regulator RNF11, which localizes to early endosomes and appears additionally in the cell nucleus upon continuous EGF stimulation. PMID: 27872256
  3. RNF11 is at the center of a finally regulated system where it acts both as an adaptor and a modulator of itch-mediated control of ubiquitination events underlying membrane traffic. PMID: 25195858
  4. Our data exemplifies the relevance of RNF11 and persistent NF-kappaB activation in Parkinson's disease PMID: 23669642
  5. The negative influence that perturbation of RNF11 and SARA levels exerts on the lysosomal degradation of EGFRs could underscore the significance of overexpression of RNF11 in certain cancers. PMID: 23222715
  6. RNF11 functions together with TAX1BP1 to restrict antiviral signaling and IFN-beta production. PMID: 23308279
  7. RNF11 negatively regulates canonical NF-kappaB signaling in the nervous system. PMID: 22507528
  8. Microglial RNF11 is a negative regulator of NF-kappaB signalling pathway and could be a strong potential target for modulating inflammatory responses in neurodegenerative diseases. PMID: 22975135
  9. Data show that membrane anchoring through acylation is necessary for RNF11 to be post-translationally modified by the addition of several ubiquitin moieties. PMID: 20676133
  10. overexpression of RNF11, through its interaction with Smurf2, can restore TGFbeta responsiveness in transfected tumor cells PMID: 14562029
  11. characterization of ring finger protein 11 PMID: 16123141
  12. RNF11 is a small RING E3 ligase that affects transforming growth factorbeta and EGF-R signaling and is overexpressed in invasive breast cancers PMID: 16925951
  13. these findings identify RNF11 as a strong candidate gene at the PARK10 locus and highlight its potential significance in the development of the common form of Parkinson disease PMID: 17917589
  14. Analysis reveals that the main determinants of selectivity between ubiquitin ligases RNF11 and E2 ubiquitin-conjugating enzymes resides on ring domains, rather than on the E2s. PMID: 18615712
  15. RNF11, together with TAX1BP1 and Itch, is an essential component of an A20 ubiquitin-editing protein complex that ensures transient activation of inflammatory signalling pathways. PMID: 19131965

Show More

Hide All

Subcellular Location
Early endosome. Recycling endosome. Cytoplasm. Nucleus.
Tissue Specificity
Expressed at low levels in the lung, liver, kidney, pancreas, spleen, prostate, thymus, ovary, small intestine, colon, and peripheral blood lymphocytes, and, at intermediate levels, in the testis, heart, brain and placenta. Highest expression in the skele
Database Links

HGNC: 10056

OMIM: 612598

KEGG: hsa:26994

STRING: 9606.ENSP00000242719

UniGene: Hs.309641

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*