Code | CSB-EP009354HU1 |
Abbreviation | Recombinant Human GDI2 protein, partial |
MSDS | |
Size | $224 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I am standardizing a protocol to detect the prenylation levels of Rab7. Summarizing the protocol my lysate (coming from a mouse cell line-N2a) is mixed with sepharose beads and recombinant GDI-GST (overnight). If the reaction works, GDI captures only prenylated Rab7, and this protein is pellet with the beads that are linked to GST. So, I was wondering if your product works for this purpose.
Can you please advise?
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDI