Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

GDI2

Uniprot No.

P50395

Research Area

Signal Transduction

Alternative Names

GDI-2; GDI2; GDIB_HUMAN; GDP dissociation inhibitor 2; Guanosine diphosphate dissociation inhibitor 2; Rab GDI beta; Rab GDP dissociation inhibitor beta; RABGDIB

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-441aa

Target Protein Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

77.2kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am standardizing a protocol to detect the prenylation levels of Rab7. Summarizing the protocol my lysate (coming from a mouse cell line-N2a) is mixed with sepharose beads and recombinant GDI-GST (overnight). If the reaction works, GDI captures only prenylated Rab7, and this protein is pellet with the beads that are linked to GST. So, I was wondering if your product works for this purpose.
Can you please advise?

Very nice to receive your inquiry. The product details are confirmed as below.
Code: CSB-RP009454h
Name: Recombinant Human Rab GDP dissociation inhibitor beta(GDI2),partial
Expression Region: 1-441aa; Partial
Tag Info: N-terminal GST-tagged
Expression Sequence:

Product Type: Developed Recombinant Protein
This protein is N-terminal GST-tagged which can be precipitated with the corresponding beads.
We have not verified the activity of the protein and cannot ensure that GDI can interact with prenylated Rab7. However, the fragment we make is only 4 aa less than the full length protein, and the function of this protein is to act on most Rab proteins. Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
It is feasible in theory. We suggest you to purchase small size and have a try first. If the protein can work in your experiment, you could share your result with us and we will provide certain discount for your re-order.

Target Background

Function

Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Gene References into Functions

Reduction of nucleoside diphosphate kinase B, Rab GDP-dissociation inhibitor beta and histidine triad nucleotide-binding protein in fetal Down syndrome brain. PMID: 11771757
The increased levels of cyclin I and GDI2 found to be associated with pancreatic carcinoma were further confirmed by Western blot analyses in an independent series of serum samples and/or pancreatic juice samples PMID: 17507299

Subcellular Location

Cytoplasm. Membrane; Peripheral membrane protein.

Protein Families

Rab GDI family

Tissue Specificity

Ubiquitous.

Database Links

HGNC: 4227

OMIM: 600767

KEGG: hsa:2665

STRING: 9606.ENSP00000369538

UniGene: Hs.299055

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP009354HU1
Abbreviation	Recombinant Human GDI2 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP009454h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) GDI2. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP009454h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) GDI2.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Rab GDP dissociation inhibitor beta (GDI2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage