Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP009354HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P50395 |
| Relevance | Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Guanosine diphosphate dissociation inhibitor 2 ;GDI-2 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | GDI2 |
| Protein Names | Recommended name: Rab GDP dissociation inhibitor beta Short name= Rab GDI beta Alternative name(s): Guanosine diphosphate dissociation inhibitor 2 Short name= GDI-2 |
| Expression Region | 1-445aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Mol. Weight | 66.7kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. |
| Subcellular Location | Cytoplasm, Membrane, Peripheral membrane protein |
| Protein Families | Rab GDI family |
| Tissue Specificity | Ubiquitous. |
| Database Links |
HGNC: 4227 OMIM: 600767 KEGG: hsa:2665 STRING: 9606.ENSP00000369538 UniGene: Hs.299055 |
GDI2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA00945D0Rb | GDI2 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA00945C0Rb | GDI2 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA00945B0Rb | GDI2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA009354GA01HU | GDI2 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA005461 | GDI2 Antibody | Human,Mouse,Rat | WB,ELISA |
| CSB-PA009354LB01HU | GDI2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA009354LC01HU | GDI2 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA009354LD01HU | GDI2 Antibody, Biotin conjugated | Human | ELISA |
GDI2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA00945A0Rb | GDI2 Antibody | Human | ELISA, WB |
| CSB-PA009354LA01HU | GDI2 Antibody | Human, Mouse | ELISA, WB, IHC |
GDI2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP009354HU | Recombinant Human Rab GDP dissociation inhibitor beta(GDI2) | Yeast |
| CSB-RP009454h | Recombinant Human Rab GDP dissociation inhibitor beta(GDI2),partial | E.coli |
| CSB-BP009354HU CSB-MP009354HU |
Recombinant Human Rab GDP dissociation inhibitor beta(GDI2) | Baculovirus Mammalian cell |
Recombinant Human Eukaryotic peptide chain release factor GTP-binding subunit ERF3A(GSPT1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Von Hippel-Lindau disease tumor suppressor(VHL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Allograft inflammatory factor 1(Aif1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Complement C1q subcomponent subunit A(C1QA)
Express system: Baculovirus
Species: Homo sapiens (Human)
Recombinant Human Apolipoprotein B-100(APOB),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Kinesin-like protein KIF1C(Kif1c)
Express system: E.coli
Species: Rattus norvegicus (Rat)
