Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)

Code CSB-EP009354HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P50395
Relevance Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Guanosine diphosphate dissociation inhibitor 2 ;GDI-2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Research Area Signal Transduction
Source E.coli
Gene Names GDI2
Protein Names Recommended name: Rab GDP dissociation inhibitor beta Short name= Rab GDI beta Alternative name(s): Guanosine diphosphate dissociation inhibitor 2 Short name= GDI-2
Expression Region 1-445aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 66.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Subcellular Location Cytoplasm, Membrane, Peripheral membrane protein
Protein Families Rab GDI family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 4227

OMIM: 600767

KEGG: hsa:2665

STRING: 9606.ENSP00000369538

UniGene: Hs.299055

Related Products

GDI2 Antibodies

GDI2 Antibodies for Homo sapiens (Human)

GDI2 Antibodies for Human

GDI2 Proteins

GDI2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.