Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SYNGAP1

Uniprot No.

Q96PV0

Research Area

Neuroscience

Alternative Names

DKFZp761G1421 ; KIAA1938; MRD5; Neuronal RasGAP; OTTHUMP00000064825; p135 SynGAP; Ras GTPase activating protein SynGAP; Ras GTPase-activating protein SynGAP; RASA 1; RASA 5; RASA1; RASA5; SYGP1_HUMAN; Synaptic Ras GAP 1; Synaptic Ras GTPase activating protein 1; Synaptic Ras GTPase activating protein 1 homolog; Synaptic Ras GTPase activating protein 135kDa; Synaptic Ras GTPase activating protein; Synaptic Ras GTPase-activating protein 1; Synaptic Ras-GAP 1; SYNGAP 1; SYNGAP1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1161-1343aa

Target Protein Sequence

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

25.5 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. Exhibits dual GTPase-activating specificity for Ras and Rap. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits.

Gene References into Functions

De novo, heterozygous, loss-of-function mutations in SYNGAP1 cause a syndromic form of intellectual disability. PMID: 26079862
This is the first description of a special electroencephalogram phenomenon (normalization with eye opening) in association with SYNGAP1 mutations. PMID: 26110312
Syngap transgenic mice exhibited alterations in long-term depression and dendritic spine morphology. PMID: 26558778
Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases. PMID: 25533468
Reduced cognition in mutant Syngap1 transgenic mice is caused by isolated damage to developing forebrain neurons. PMID: 24945774
De novo CHD2 and SYNGAP1 mutations are new causes of epileptic encephalopathies, accounting for 1.2% and 1% of cases, respectively. PMID: 23708187
De novo missense mutations, p.R579X, and possibly all the other truncating mutations in SYNGAP1 result in a loss of its function, causing intellectual disability, autism, and a specific form of epilepsy. PMID: 23161826
SYNGAP1 is a brain-specific protein that interacts with key components of the proteins involved in experience-dependent changes in glutamate synapses involved in learning. PMID: 21480541
We provide evidence that truncating mutations in SYNGAP1 are common in nonsyndromic intellectual disability and can be also associated with autism. PMID: 21237447
The C2 domain of SynGAP is essential for stimulation of the Rap GTPase reaction. PMID: 18323856
Results indicate that SYNGAP1 disruption is a cause of autosomal dominant nonsyndromic mental retardation. PMID: 19196676

Hide All

Involvement in disease

Mental retardation, autosomal dominant 5 (MRD5)

Database Links

HGNC: 11497

OMIM: 603384

KEGG: hsa:8831

STRING: 9606.ENSP00000403636

UniGene: Hs.586264

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP857006HU
MSDS	MSDS
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage