Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP019297HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P11234 |
| Relevance | Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | RALB |
| Protein Names | Recommended name: Ras-related protein Ral-B |
| Expression Region | 1-206aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 50.1kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis |
| Subcellular Location | Cell membrane, Lipid-anchor, Cytoplasmic side, Midbody |
| Protein Families | Small GTPase superfamily, Ras family |
| Database Links |
HGNC: 9840 OMIM: 179551 KEGG: hsa:5899 STRING: 9606.ENSP00000272519 UniGene: Hs.469820 |
| Pathway |
Ras signaling pathway
Phospholipase D signaling pathway Rap1 signaling pathway |
RALB Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019297GA01HU | RALB Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA283609 | RALB Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA219431 | RALB Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
RALB Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019297ESR2HU | RALB Antibody | Human, Mouse | ELISA, WB, IHC |
RALB Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP019297HU CSB-BP019297HU CSB-MP019297HU |
Recombinant Human Ras-related protein Ral-B(RALB) | Yeast Baculovirus Mammalian cell |
Recombinant Bovine Glycolipid transfer protein(GLTP)
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Eukaryotic translation initiation factor 4 gamma 1(EIF4G1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Lysine-specific demethylase 5A(KDM5A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Dog Annexin A4(ANXA4)
Express system: E.coli
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
