Recombinant Human Ras-related protein Ral-B(RALB)

Code	CSB-EP019297HU
Size	US$1726
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	RALB
Uniprot No.	P11234
Research Area	Signal Transduction
Alternative Names	5730472O18Rik; dRalb; GTP binding protein; Ralb; RALB_HUMAN; RAS like protein B; RAS like proto oncogene B; Ras related GTP binding protein B; Ras-related protein Ral-B; v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein); v ral simian leukemia viral oncogene homolog B (ras related); V ral simian leukemia viral oncogene homolog B
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	1-206aa
Target Protein Sequence	MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	50.1kDa
Protein Length	Full Length
Tag Info	N-terminal GST-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis
Gene References into Functions	our work provides new insight into the specific roles of Ras effector pathways in acute myeloid leukemia and has identified RALB signaling as a key survival pathway PMID: 27556501 High RALB expression is associated with acute myeloid leukemia. PMID: 27991934 Inhibition of Ral GTPases Using a Stapled Peptide Approach. PMID: 27334922 These findings suggest that RalB might be one of the targets for facilitating the invasive phenotype of malignant gliomas induced by GGTase-I. PMID: 25573158 High RALB mRNA expression is associated with non-small-cell lung cancer growth and progression. PMID: 24389431 Integrin alpha(v)beta expression and the resulting KRAS-RalB-NF-kappaB pathway were both necessary and sufficient for tumour initiation, anchorage independence, self-renewal and erlotinib resistance. PMID: 24747441 nutrient starvation induces RALB deubiquitylation by accumulation and relocalization of the deubiquitylase USP33 to RALB-positive vesicles PMID: 24056301 a novel RalB-mediated biochemical and signaling mechanism for invadopodium formation PMID: 22331470 Study finds that the Ras-like small G protein, RalB, is localized to nascent autophagosomes and is activated on nutrient deprivation. PMID: 21241894 Non-phosphorylated RalB is associated with bladder cancer cell growth and metastasis. PMID: 20940393 RALA and RALB collaborate to maintain tumorigenicity through regulation of both proliferation and survival; RALB is specifically required for survival of tumour cells but not normal cells PMID: 12856001 These observations define the mechanistic contribution of RalGTPases to cancer cell survival and reveal the RalB/Sec5 effector complex as a component of TBK1-dependent innate immune signaling. PMID: 17018283 RalB was found to mediate SDF-1-induced migration PMID: 18227351 Backbone dynamics and the structure of free RalB bound to the GTP analogue GMPPNP were determined using NMR spectroscopy. PMID: 19166349 1H, 13C and 15N resonance assignments for the small G protein RalB in its active conformation. Backbone amide dynamics parameters for a majority of residues have also been obtained PMID: 19636851 Show More Hide All
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side, Midbody
Protein Families	Small GTPase superfamily, Ras family
Database Links	HGNC: 9840 OMIM: 179551 KEGG: hsa:5899 STRING: 9606.ENSP00000272519 UniGene: Hs.469820