Code | CSB-EP019297HU |
Size | US$1726 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | RALB |
Uniprot No. | P11234 |
Research Area | Signal Transduction |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-206aa |
Target Protein Sequence | MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 50.1kDa |
Protein Length | Full Length |
Tag Info | N-terminal GST-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis |
Subcellular Location | Cell membrane, Lipid-anchor, Cytoplasmic side, Midbody |
Protein Families | Small GTPase superfamily, Ras family |
Database Links |
HGNC: 9840 OMIM: 179551 KEGG: hsa:5899 STRING: 9606.ENSP00000272519 UniGene: Hs.469820 |
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Vascular endothelial growth factor B(VEGFB)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human 40S ribosomal protein SA(RPSA),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 1(KRT1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Tumor necrosis factor receptor superfamily member 21(TNFRSF21),partial
Express system: E.coli
Species: Homo sapiens (Human)