Recombinant Human Ras-related protein Rap-2b(RAP2B)

Code CSB-EP019327HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P61225
Relevance Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC
Research Area Signal Transduction
Source E.coli
Gene Names RAP2B
Protein Names Recommended name: Ras-related protein Rap-2b
Expression Region 1-183aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
Subcellular Location Recycling endosome membrane, Lipid-anchor, Cytoplasmic side
Protein Families Small GTPase superfamily, Ras family
Tissue Specificity Expressed in red blood cells (at protein level).
Database Links

HGNC: 9862

OMIM: 179541

KEGG: hsa:5912

STRING: 9606.ENSP00000319096

UniGene: Hs.700713

Related Products

RAP2B Antibodies

RAP2B Antibodies for Homo sapiens (Human)

RAP2B Antibodies for Human

RAP2B Proteins

RAP2B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.