Recombinant Human Ras-related protein Rap-2b (RAP2B)

Code CSB-EP019327HU
Abbreviation Recombinant Human RAP2B protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RAP2B
Uniprot No.
Research Area
Signal Transduction
Alternative Names
MGC20484; RAP 2B; RAP2A; Rap2b; RAP2B member of RAS oncogene family; RAP2B_HUMAN; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; Ras related protein RAP2B; Ras-related protein Rap-2b; Small GTP binding protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-183aa
Target Protein Sequence
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.2kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
Gene References into Functions
  1. Rap2B was overexpressed in cervical cancer tissues and cell lines and knockdown of Rap2B inhibited cervical cancer cell proliferation, migration, and invasion in vitro and suppressed cervical cancer cell growth and metastasis in vivo PMID: 28390112
  2. these results revealed that Rap2B promotes renal cell carcinoma angiogenesis via phosphoinositide 3-kinase/AKT/vascular endothelial growth factor signaling pathway, which suggests that Rap2B is a novel therapeutic target for renal cell carcinoma anti-angiogenesis therapy. PMID: 28691643
  3. our results suggested that Rap2b may be a potential therapeutic target for lung cancer. PMID: 26671640
  4. knockdown of Rap2B inhibits the proliferation and invasion in HCC cells. These findings reveal that Rap2B plays an important role in the regulation of HCC progression. PMID: 28081729
  5. miR-194 is inversely correlated with RAP2B. PMID: 27133066
  6. Western blot analysis uncovered that elevated Rap2B leads to increased phosphorylation levels of FAK, suggesting that FAK-dependent pathway might be responsible for the effect of Rap2B on PCa cells migration and invasion. PMID: 27154636
  7. Expression and DNA methylation status of the Rap2B gene in human bronchial epithelial cells treated by cigarette smoke condensate PMID: 26308105
  8. Our collective findings provide preliminary evidence that miR-342-3p acts as a tumor suppressor in small cell lung cancer through repression of RAP2B. PMID: 25663460
  9. Rap2B itself is not necessary for p53-dependent cell cycle arrest. PMID: 25762091
  10. Data indicate that rap GTP-binding protein Rap2B expression is significantly increased in suprarenal epithelioma and Rap2B can promote the cell migration and invasion abilities, suggesting a target for the treatment of suprarenal epithelioma. PMID: 24951956
  11. Rap2b is a conserved p53-activated gene that counters p53-mediated apoptosis after DNA damage. PMID: 23535297
  12. Rap2b mediates the pro-survival function of p53 upon DNA damage. PMID: 23535297
  13. Stimulation of phospholipase C-epsilon by the M3 muscarinic acetylcholine receptor mediated by cyclic AMP and the GTPase Rap2B PMID: 11877431
  14. the small GTPase Rap2B is involved in platelet activation PMID: 15613030
  15. A cDNA library consisting of 220 upregulated genes in tumour tissue was established and named as LSCC. Differential expression was confirmed in five of these genes, including IGFBP5, SQLE, RAP2B, CLDN1, and TBL1XR1. PMID: 17316888

Show More

Hide All

Subcellular Location
Recycling endosome membrane; Lipid-anchor; Cytoplasmic side. Note=Associated with red blood cells-released vesicles.
Protein Families
Small GTPase superfamily, Ras family
Tissue Specificity
Expressed in red blood cells (at protein level).
Database Links

HGNC: 9862

OMIM: 179541

KEGG: hsa:5912

STRING: 9606.ENSP00000319096

UniGene: Hs.700713

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*