Recombinant Human Regulator of G-protein signaling 10(RGS10)

Code CSB-EP019642HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O43665
Relevance Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Modulates the activity of potassium channels that are activated in response to CHRM2 signaling. Activity on GNAZ is inhibited by palmitoylation of the G-protein
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Research Area Signal Transduction
Source E.coli
Gene Names RGS10
Protein Names Recommended name: Regulator of G-protein signaling 10 Short name= RGS10
Expression Region 1-181aa
Tag Info N-terminal GST-tagged
Mol. Weight 48.2kDa
Protein Description Full Length of Isoform 3
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form
Subcellular Location Cytoplasm, cytosol, Nucleus
Database Links

HGNC: 9992

OMIM: 602856

KEGG: hsa:6001

STRING: 9606.ENSP00000358099

UniGene: Hs.501200

Related Products

RGS10 Antibodies

RGS10 Antibodies for Homo sapiens (Human)

RGS10 Antibodies for Human

RGS10 Proteins

RGS10 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.