Recombinant Human Regulator of G-protein signaling 5(RGS5)

Code CSB-EP019657HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O15539
Relevance Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Research Area Signal Transduction
Source E.coli
Gene Names RGS5
Protein Names Recommended name: Regulator of G-protein signaling 5 Short name= RGS5
Expression Region 1-181aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha (By similarity).
Subcellular Location Isoform 1: Cytoplasm, Membrane, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
Database Links

HGNC: 10001

OMIM: 603276

KEGG: hsa:8490

STRING: 9606.ENSP00000319308

UniGene: Hs.24950

Related Products

RGS5 Antibodies

RGS5 Antibodies for Homo sapiens (Human)

RGS5 Antibodies for Human

RGS5 Proteins

RGS5 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.