Recombinant Human Remodeling and spacing factor 1 (RSF1), partial

In Stock
Code CSB-EP020540HU
Abbreviation Recombinant Human RSF1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
RSF1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
HBV pX-associated protein 8;Hepatitis B virus X-associated protein;p325 subunit of RSF chromatin-remodeling complex
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1343-1441aa
Target Protein Sequence
IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulatory subunit of the ATP-dependent RSF-1 and RSF-5 ISWI chromatin-remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair. Binds to core histones together with SMARCA5, and is required for the assembly of regular nucleosome arrays by the RSF-5 ISWI chromatin-remodeling complex. Directly stimulates the ATPase activity of SMARCA1 and SMARCA5 in the RSF-1 and RSF-5 ISWI chromatin-remodeling complexes, respectively. The RSF-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the RSF-5 ISWI chromatin-remodeling complex. The complexes do not have the ability to slide mononucleosomes to the center of a DNA template. Facilitates transcription of hepatitis B virus (HBV) genes by the pX transcription activator. In case of infection by HBV, together with pX, it represses TNF-alpha induced NF-kappa-B transcription activation. Represses transcription when artificially recruited to chromatin by fusion to a heterogeneous DNA binding domain.
Gene References into Functions
  1. Remodeling and spacing factor 1 (RSF1) stability is regulated at the post-translational level upon DNA damage. PMID: 29385673
  2. Results show that RSF1 is highly expressed in bladder cancer tissues (BC) and is negatively correlated with miR-154 levels. RSF1 is a direct target by miR-154 in BC cells. There was however no significant effect on RSF1 mRNA levels, which may be due to incomplete complementation with the 3'-UTR. PMID: 29048677
  3. In osteosarcoma patients, RSF1 was increased and associated with advanced clinical features and poor overall survival. PMID: 28843909
  4. these data identify RSF1 as a H2Aub reader that contributes to H2Aub-mediated gene silencing by maintaining a stable nucleosome pattern at promoter regions. PMID: 28855339
  5. Rsf-1 was highly expressed in H460 and H1299 cells. Rsf-1 knockout caused cell arrest at the G1 phase, increased cell apoptosis, and decreased migration and cell proliferation. Rsf-1 knockout increased the inhibition of cell proliferation, the reduction in cell migration and the augment in cell apoptosis in paclitaxel treated H460 and H1299 cells. PMID: 29258089
  6. Rsf-1 was overexpressed in lung cancer and associated with poor survival. Rsf-1 regulated cell invasion through MMP2 and NF-kappaB pathway. PMID: 28289901
  7. essential centromeric component that recruits PLK1 to kinetochores and plays a crucial role in faithful cell division PMID: 26259146
  8. High-expression of Rsf-1 is associated with pathologic subtypes of breast cancer, aggressive phenotype, p53 positive and poor clinical outcome, which confers tumor aggressiveness through chromatin remodeling. PMID: 25337201
  9. RSF1 facilitates DNA double-strand break repair by recruiting centromeric and Fanconi Anaemia proteins. PMID: 24800743
  10. Chromatin remodeler Rsf-1 is a guard in DNA damage checkpoints and homologous recombination repair. PMID: 24351651
  11. RSF1 plays a critical role in DNA double stranded break repair, a process in which it acts independently from its binding partner SMARCA5. PMID: 25111480
  12. Rsf-1 contributes to hepatocellular carcinoma cell growth through regulation of cell cycle proteins. PMID: 24798976
  13. Rsf-1 contributes to prostate cancer cell growth and invasion, which makes it a candidate therapeutic target. PMID: 24584698
  14. Remodeling and spacing factor 1 promotes the assembly of CENP-S and CENP-X at damaged chromatin and regulates DSB repair by homologous recombination and non-homologous end-joining. PMID: 23974106
  15. Serum HBXAP DNA from 65 lung cancer patients and 20 healthy controls was quantified using real-time fluorescent quantitative polymerase chain reaction. PMID: 23456648
  16. Rsf-1 increases the frequency of abnormal mitotic events by disrupting hBubR1-Cdc20 interactions. PMID: 23536579
  17. Rsf-1 interacts and collaborates with cyclin E1 in neoplastic transformation and TP53 mutations are a prerequisite for tumour-promoting functions of the RSF/cyclin E1 complex. PMID: 23378270
  18. High RSF-1 expression correlates with poor prognosis in patients with gastric adenocarcinoma. PMID: 22977663
  19. Rsf-1 is overexpressed in colon cancers and contributes to malignant cell growth by cyclin E and phospho-Rb modulation, which makes Rsf-1 a candidate therapeutic target in colon cancer. PMID: 22528946
  20. Overexpression of Rsf-1 is associated with higher tumour stage and poorer clinical outcome in urinary bladder urothelial carcinoma. PMID: 22685262
  21. High-expression of Rsf-1 is associated with poor therapeutic response and adverse outcome in rectal cancer patients treated with neoadjuvant chemoradiotherapy. PMID: 22569540
  22. Rsf-1 is overexpressed in non-small cell lung cancers and contributes to malignant cell growth by cyclin D1 and ERK modulation. PMID: 22387541
  23. Rsf-1 overexpression is common and is associated with adverse prognosticators and therapeutic response in nasopharyngeal carcinoma. PMID: 22081787
  24. Rsf-1 overexpression is common and associated with adverse prognosticators in gallbladder carcinomas. PMID: 21995635
  25. our results suggest that RSF-1 up-regulation is associated with several clinicopathological features of disease aggressiveness in oral squamous cell carcinoma PMID: 21514451
  26. a higher expression level of Rsf-1 is associated with advanced clinical stage and lymph node metastasis in ovarian clear-cell carcinoma. PMID: 21131837
  27. Rsf-1, a chromatin remodeling protein, induces DNA damage and promotes genomic instability PMID: 20923775
  28. Suggest that overexpression of Rsf-1, cyclin E and FASN occurs early in ovarian tumor progression. PMID: 20228782
  29. HBXAP represses NF-kappaB-mediated gene activation in a dose-dependent manner. Our results showed that HBXAP and NF-kappaB colocalize to the nuclear matrix with specific physical interaction between them. PMID: 15242768
  30. An important role of Rsf-1 amplification in ovarian cancer was shown. PMID: 16172393
  31. Putative oncogene in ovarian cancer. PMID: 16418735
  32. Rsf-1 expression is down-regulated in breast carcinoma cells in effusions compared with the solid counterparts and has no prognostic role at this anatomic site. PMID: 18289639
  33. In an ovarian carcinoma cohort, RSF1 was amplified in 12% of the cases. It was correlated with serous histology and a worse prognosis. The 11q13 amplicon in ovarian cancer is likely driven by a cassette of genes rather than by a single oncogene. PMID: 18314909
  34. findings suggest that interaction between Rsf-1 and hSNF2H may define a survival signal in those tumors overexpressing Rsf-1 PMID: 18519663
  35. Rsf-1 is the major gene within the 11q13.5 amplicon that contributes to paclitaxel resistance in ovarian cancers. PMID: 19190325
  36. continued expression of the ATX transgenes can contribute to hepatocyte transformation but are not sufficient to trigger neoplastic changes in the liver PMID: 19475691

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Ubiquitously expressed. Highly expressed in the heart, skeletal muscle, kidney and placenta. Expressed at low levels in the brain and colon.
Database Links

HGNC: 18118

OMIM: 608522

KEGG: hsa:51773

STRING: 9606.ENSP00000311513

UniGene: Hs.420229

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*