Recombinant Human Renin receptor (ATP6AP2)

In Stock
Code CSB-EP002384HUa2
Abbreviation Recombinant Human ATP6AP2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase H+ transporting lysosomal accessory protein 2; ATPase H+ transporting lysosomal interacting protein 2; ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9; ATPase membrane sector associated protein M8 9; ATPase; H+ transporting; lysosomal (vacuolar proton pump) membrane sector associated protein M8 9; CAPER; ELDF10; Embryonic liver differentiation factor 10; ER localized type I transmembrane adaptor; ER-localized type I transmembrane adaptor; HT028; M8 9; M8-9; MGC99577; MRXE; MSTP009; N14F; Renin receptor; Renin/prorenin receptor; RENR_HUMAN; V ATPase M8 9 subunit; V ATPase M8.9 subunit; V-ATPase M8.9 subunit; Vacuolar ATP synthase membrane sector associated protein M8 9; Vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8 9; XMRE
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
17-350aa
Target Protein Sequence
NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human renin receptor (ATP6AP2) comes from E.coli production, with an expression region covering amino acids 17-350—essentially the complete mature protein. It carries an N-terminal 6xHis-SUMO tag that aids in both purification and detection. SDS-PAGE analysis confirms the product reaches greater than 90% purity, which appears to support reliable research outcomes.

The renin receptor, or ATP6AP2, seems to play an important role in the renin-angiotensin system that helps control blood pressure and electrolyte balance. Beyond these pathways, ATP6AP2 is likely involved in cellular processes like proton transport and protein folding. This makes it particularly interesting for cardiovascular and metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag makes nickel affinity-based pull-down experiments possible for identifying potential binding partners of the renin receptor. With >90% purity, there's minimal background interference from contaminating proteins during interaction studies. Researchers can attach this recombinant protein to nickel-coated beads and mix it with cell lysates or purified protein libraries to capture interacting molecules. The SUMO tag may provide extra structural stability and could help the protein fold properly for more natural interactions.

2. Antibody Development and Validation

This highly pure recombinant ATP6AP2 protein works well as an immunogen for creating specific antibodies against the human renin receptor. The 334-amino acid construct (17-350aa) covers a substantial portion of the mature protein, offering multiple epitopes for antibody recognition. The His-SUMO tag can be used in ELISA-based screening assays to find high-affinity antibodies during hybridoma selection. The protein also serves as a positive control when validating newly developed antibodies through Western blot analysis.

3. Biochemical Characterization and Stability Studies

This recombinant protein allows for thorough biochemical analysis—thermal stability profiling, pH tolerance testing, and buffer optimization studies. The >90% purity should enable accurate protein concentration determination and reliable biophysical measurements. Scientists can examine how the protein behaves under different conditions to establish the best storage and handling protocols. The His tag makes purification straightforward for repeated experiments and allows concentration adjustments for dose-response studies.

4. In Vitro Binding Assays with Known Ligands

This recombinant ATP6AP2 can be used to study binding interactions with known renin receptor ligands or potential small molecule compounds in plate-based assays. The His tag allows for straightforward attachment to nickel-coated surfaces for surface plasmon resonance or other label-free binding studies. High purity should reduce non-specific binding events that might interfere with binding affinity measurements. Such studies may provide valuable kinetic and thermodynamic parameters for receptor-ligand interactions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (v-ATPase) and the acidification of the endo-lysosomal system. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, may also play a role in the renin-angiotensin system (RAS). Through its function in V-type ATPase (v-ATPase) assembly and acidification of the lysosome it regulates protein degradation and may control different signaling pathways important for proper brain development, synapse morphology and synaptic transmission.
Gene References into Functions
  1. Increased level of s (pro) RR in first trimester may be a marker for predicting gestational diabetes mellitus PMID: 27654965
  2. Soluble (pro)renin receptor is dysregulated in pregnancies affected by diabetes mellitus, but not in preeclampsia. PMID: 29050747
  3. maternal serum concentrations may reflect acceleration of tissue renin-angiotensin system in the placenta and blood pressure severity PMID: 28864001
  4. The aim of this review, is to highlight new insights into the cellular and molecular mechanisms by which PRR may regulate UB branching, terminal differentiation and function of UB-derived collecting ducts, nephron progenitor maintenance, progression of nephrogenesis and normal structural kidney development and function--{REVIEW} PMID: 27160552
  5. Overexpression of PRR is associated with pancreatic ductal adenocarcinoma. PMID: 28874965
  6. the missense mutations in ATP6AP2 lead to impaired V-ATPase assembly and subsequent defects in glycosylation and autophagy. PMID: 29127204
  7. High ATP6AP2 expression is associated with Renal Damage. PMID: 27228084
  8. serum s(P)RR could be used as a marker for atherosclerotic conditions in hemodialysis patients PMID: 27367528
  9. (P)RR may contribute to the homeostatic control of erythropoiesis. PMID: 28090037
  10. Placental (P)RR can be involved in blood pressure regulation via the tissue RAS. On the other hand, plasma s(P)RR may be involved in the pathogenesis of decreased renal function in preeclampsia. PMID: 26684753
  11. the present results suggest that ATP6AP2 rs5918007T might be susceptible factors for Essential Hypertension in Chinese Han population. PMID: 26625836
  12. A mutation in the splice site following exon 2 may affect splicing due to its close proximity to the exon-intron boundary. It was associated with epilepsy, Parkinsonism and intellectual disability in 2 brothers. PMID: 26467484
  13. Study identifies a renin-angiotensin system-independent function for the (P)RR in the regulation of LDL metabolism by controlling the levels of SORT1 and LDL receptor. PMID: 26582775
  14. markedly expressed in adrenocortical zona glomerulosa and aldosterone-producing adenoma PMID: 25668351
  15. Prorenin receptor promotes atrial structural and electric remodeling and plays an important role in the pathological development of atrial fibrillation. PMID: 25697868
  16. Demonstrate that there are strong interactions between prorenin, ATP6AP2, and TGFB1 and that this system has a greater capacity in female amnion to stimulate profibrotic pathways, thus maintaining the integrity of the fetal membranes. PMID: 25491485
  17. a novel GLP1R Interacting Protein ATP6ap2 PMID: 26272612
  18. Crosstalk between (Pro)renin receptor and COX-2 in the renal medulla during angiotensin II-induced hypertension PMID: 25681793
  19. This is the first demonstration that (P)RR may be profoundly involved in ductal tumorigenesis in the pancreas. PMID: 25747895
  20. The binding of prorenin to PRR can promote proliferation and upregulate the anti-apoptotic protein Bcl-2 and downregulate the pro-apoptotic protein Bax independently PMID: 24591529
  21. MicroRNA-152 represses VEGF and TGFbeta1 expressions through post-transcriptional inhibition of prorenin receptor in human retinal endothelial cells. PMID: 25802486
  22. Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability PMID: 25720494
  23. expressed by lymphocytes and macrophages PMID: 25503726
  24. activation of (P)RR and AT1R is associated with the pathogenesis of conjunctival EMZL by stimulating the production of FGF2 and MMPs. PMID: 25503453
  25. The aim of this study was to analyse the contribution of constitutive (P)RR activity to its cellular effects and the relevance of prorenin glycosylation on its ligand activity. PMID: 24424509
  26. The extracellular domain (ECD) and transmembrane domain (TM) of ATP6AP2 were indispensable for the biogenesis of active V-ATPase. PMID: 24223829
  27. The expression of (P)RR in erythroid cells, raising the possibility that (P)RR may have a role in erythropoiesis and the pathophysiology of certain types of anemia. PMID: 22884881
  28. Plasma levels of prorenin receptor are increased in heart failure patients with renal dysfunction. PMID: 23673200
  29. This study demonstrates that the the extracellular domain of ATP6AP2 participates in dimerization. PMID: 24472541
  30. Pro)renin receptor and insulin resistance: possible roles of angiotensin II-dependent and -independent pathways. [review] PMID: 22684035
  31. Plasma sPRR concentrations are dependent on ethnicity and independent of renin, prorenin, and aldosterone concentrations in healthy subjects and in patients with contrasted degrees of renin-angiotensin system activity. PMID: 24218434
  32. Studies indicated that various polymorphisms in the (P)RR/ATP6ap2 gene associated with increased cardiovascular risks. PMID: 24400720
  33. Results show that reduction of the full-size ATP6AP2 transcript in XPDS cells and decreased level of ATP6AP2 protein in XPDS brain may compromise V-ATPase function and may ultimately be responsible for the pathology. PMID: 23595882
  34. High s(P)RR concentration is associated with a lower SGA birth likelihood. PMID: 23555874
  35. Report the presence of prorenin receptor in human substantia nigra. PMID: 22407459
  36. The(pro)renin receptor mediates EGF receptor transactivation in both Ang II-dependent and -independent pathways. PMID: 23277024
  37. These in vitro data indicate that prorenin acidified in vivo possibly modulate renin angiotensin system in (pro)renin receptor-dependent and/or -independent manners which could ultimately lead to the pathogenesis of diseases. PMID: 23111329
  38. Our data using human samples provide the first evidence that prorenin receptor is associated with angiogenic activity in proliferative diabetic retinopathy. PMID: 22930161
  39. Data indicate that high circulating levels of s(P)RR at early pregnancy predicted a subsequent elevation in blood pressure, and high concentrations at delivery were significantly associated with preeclampsia. PMID: 23045457
  40. Prorenin is a chemotactic factor for human aortic smooth muscle cells expressing prorenin receptor. PMID: 22721990
  41. (P)RR gene activity may be controlled by intracellular AngII. PMID: 21997900
  42. Angiotensin generation depending on prorenin-(P)RR interaction may occur in transgenic rodents overexpressing prorenin several 100-fold. PMID: 22025376
  43. Decidual prorenin may be involved in the labour-associated increase in amnion PGHS-2 abundance via the (pro)renin receptor. PMID: 20702505
  44. that (P)RR influences blood pressure regulation in Caucasian men, potentially through altered aldosterone release PMID: 21346687
  45. Prorenin receptor is mainly localized in the subcellular organelles, such as the endoplasmic reticulum and Golgi apparatus, and the prorenin receptor is cleaved by ADAM19 in the Golgi, resulting in two fragments. PMID: 21270819
  46. The polymorphism of the (P)RR gene +1513A>G is associated with lacunar infarction and left ventricular hypertrophy in Japanese women. These results suggest that (P)RR has a role in organ damage in humans PMID: 21228785
  47. Report expression (pro)renin receptors and angiotensin converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in human aortic valve stenosis. PMID: 21316680
  48. the crystal structure of the PRR-IC domain as maltose-binding protein (MBP) fusion proteins at 2.0A (maltose-free) and 2.15A (maltose-bound) was reported. PMID: 21420935
  49. Demonstrate that the (pro)renin receptor (PRR) is expressed in retinal pigment epithelium and may have a role in hypertensive exacerbation of dry age-related macular degeneration. PMID: 19580809
  50. Expression of (pro)renin receptor in human kidneys with end-stage kidney disease due to diabetic nephropathy PMID: 20385187

Show More

Hide All

Involvement in disease
Mental retardation, X-linked, with epilepsy (MRXE); Parkinsonism with spasticity, X-linked (XPDS)
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome membrane. Cytoplasmic vesicle, autophagosome membrane. Cell projection, dendritic spine membrane. Cell projection, axon. Endosome membrane.
Tissue Specificity
Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium,
Database Links

HGNC: 18305

OMIM: 300423

KEGG: hsa:10159

STRING: 9606.ENSP00000367697

UniGene: Hs.495960

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*